Mouse anti-Human ZNF653 Polyclonal Antibody | anti-Zfp653 antibody

ZNF653 (Zinc Finger Protein 653, 67 kDa Zinc Finger Protein, E430039K05Rik, Zinc Finger Protein Zip67, ZIP67)

Cat. Num. AAA6011216

• Gene Names: Zfp653; Znf653; E430039K05Rik
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF653; Polyclonal Antibody; ZNF653 (Zinc Finger Protein 653; 67 kDa Zinc Finger Protein; E430039K05Rik; Zinc Finger Protein Zip67; ZIP67); Anti -ZNF653 (Zinc Finger Protein 653; anti-Zfp653 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF653.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAERALEPEAEAEAEAGAGGEAAAEEGAAGRKARGRPRLTESDRARRRLESRKRYDVRRVYLGEAHGPWVDLRRRSGWSDAKLAAYLISLERGQRSGRHGKPWEQVPKKPKRKKRRRRNVNCLKNVVIWYEDHKHRCPYEPHLAELDPTFGLYTTAVWQCEAGHRYFQDLHSPLKPLSDSDPDSDKVGNGLVAGSSDSSSSGSASDSEESPEGQPVKAAAAAAAATPTSPVGSSGLITQEGVHIPFDVHHVESLAEQGTPLCSNPAGNGPEALETVVCVPVPVQVGAGPSALFENVPQEALGEVVASCPMPGMVPGSQVIIIAGPGYDALTAEGIHLNMAAGSGVPGSGLGEEVPCAMMEGVAAYTQTEPEGSQPSTMDATAVAGIETKKEKEDLCLLKKEEKEEPVAPELATTVPESAEPEAEADGEELDGSDMSAIIYEIPKEPEKRRRSKRSRVMDADGLLEMFHCPYEGCSQVYVALSSFQNHVNLVHRKGKTKVCPHPGCGKKFYLSNHLRRHMIIHSGVREFTCETCGKSFKRKNHLEVHRRTHTGETPLQCEICGYQCRQRASLNWHMKKHTAEVQYNFTCDRCGKRFEKLDSVKFHTLKSHPDHKPT

• Applicable Applications for anti-Zfp653 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF653, aa1-615 (NP_620138.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF653 polyclonal antibody. Western Blot analysis of ZNF653 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of ZNF653 expression in transfected 293T cell line by ZNF653 polyclonal antibody. Lane 1: ZNF653 transfected lysate (67.65kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF653 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-Zfp653 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 29789439
• NCBI GeneID: 319601
• NCBI Accession #: NP_796292.1
• NCBI GenBank Nucleotide #: NM_177318.2
• UniProt Accession #: Q6YND2; Q8BHT8; Q8CI02
• Molecular Weight: 67,517 Da
• NCBI Official Full Name: zinc finger protein 653
• NCBI Official Synonym Full Names: zinc finger protein 653
• NCBI Official Symbol: Zfp653
• NCBI Official Synonym Symbols: Znf653; E430039K05Rik
• NCBI Protein Information: zinc finger protein 653; Zip67; zinc finger protein Zip67; 67 kDa zinc finger protein
• UniProt Protein Name: Zinc finger protein 653
• UniProt Gene Name: Znf653
• UniProt Synonym Gene Names: Zfp653; Zip67
• UniProt Entry Name: ZN653_MOUSE

Uniprot Description

ZNF653: Transcriptional repressor. May repress NR5A1, PPARG, NR1H3, NR4A2, ESR1 and NR3C1 transcriptional activity. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: Nuclear receptor co-regulator; C2H2-type zinc finger protein; DNA-binding

Cellular Component: nucleus

Molecular Function: DNA binding; nucleic acid binding; metal ion binding

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent