Western Blot (WB)
(Western Blot analysis of ZNF502 expression in transfected 293T cell line by ZNF502 polyclonal antibody. Lane 1: ZNF502 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ZNF502 Polyclonal Antibody | anti-ZNF502 antibody
ZNF502 (Zinc Finger Protein 502)
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZNF502; Polyclonal Antibody; ZNF502 (Zinc Finger Protein 502); Anti -ZNF502 (Zinc Finger Protein 502); anti-ZNF502 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ZNF502.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQKKSWKCNECGKTFTQSSSLTQHQRTHTGERPYTCEECGKAFSRSSFLVQHQRIHTGVKPYGCEQCGKTFRCRSFLTQHQRIHTGEKPYKCNECGNSFRNHSHLTEHQRIHTGEKPYKCNRCGKAFNQNTHLIHHQRIHTGEKPYICSECGSSFRKHSNLTQHQRIHTGEKPHKCDECGKTFQTKANLSQHQRIHSGEKPYKCKECGKAFCQSPSLIKHQRIHTGEKPYKCKECGKAFTQSTPLTKHQRIHTGERPYKCSECGKAFIQSICLIRHQRSHTGEKPYKCNECGKGFNQNTCLTQHMRIHTGEKPYKCKECGKAFAHSSSLTEHHRTHTGEKLYKCSECEKTFRKYAHLSEHYRIHTGEKPYECIECGKFFRHSSVLFRHQKLHSGD
Applicable Applications for anti-ZNF502 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ZNF502, aa1-544 (NP_149987.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ZNF502 expression in transfected 293T cell line by ZNF502 polyclonal antibody. Lane 1: ZNF502 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ZNF502 expression in transfected 293T cell line by ZNF502 polyclonal antibody. Lane 1: ZNF502 transfected lysate (59.84kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZNF502 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ZNF502 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-ZNF502 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,920 Da
NCBI Official Full Name
zinc finger protein 502
NCBI Official Synonym Full Names
zinc finger protein 502
NCBI Official Symbol
ZNF502
NCBI Protein Information
zinc finger protein 502
UniProt Protein Name
Zinc finger protein 502
Protein Family
UniProt Gene Name
ZNF502
UniProt Entry Name
ZN502_HUMAN
Uniprot Description
ZNF502: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.
Protein type: C2H2-type zinc finger protein
Chromosomal Location of Human Ortholog: 3p21.31
Cellular Component: nucleus
Molecular Function: DNA binding; metal ion binding
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Similar Products
Product Notes
The ZNF502 znf502 (Catalog #AAA6009873) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF502 (Zinc Finger Protein 502) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF502 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ZNF502 znf502 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLNMQGAEER DIRRETCPGW VNKNKPALEQ DVCKIDSSGI VVKRFQEDEY QDSTFEEKYA CEGMKENSPR EIAESCLFQE GGFGRITFIH KEAPPEIISQ GYNFEKSLLL TSSLVTRLRV STEESLHQWE TSNIQTNDIS DQSKCPTLCT QKKSWKCNEC GKTFTQSSSL TQHQRTHTGE RPYTCEECGK AFSRSSFLVQ HQRIHTGVKP YGCEQCGKTF RCRSFLTQHQ RIHTGEKPYK CNECGNSFRN HSHLTEHQRI HTGEKPYKCN RCGKAFNQNT HLIHHQRIHT GEKPYICSEC GSSFRKHSNL TQHQRIHTGE KPHKCDECGK TFQTKANLSQ HQRIHSGEKP YKCKECGKAF CQSPSLIKHQ RIHTGEKPYK CKECGKAFTQ STPLTKHQRI HTGERPYKCS ECGKAFIQSI CLIRHQRSHT GEKPYKCNEC GKGFNQNTCL TQHMRIHTGE KPYKCKECGK AFAHSSSLTE HHRTHTGEKL YKCSECEKTF RKYAHLSEHY RIHTGEKPYE CIECGKFFRH SSVLFRHQKL HSGD. It is sometimes possible for the material contained within the vial of "ZNF502, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
