Mouse anti-Human ZNF383 Polyclonal Antibody | anti-ZNF383 antibody

ZNF383 (Zinc Finger Protein 383, HSD17)

Cat. Num. AAA6001017

• Gene Names: ZNF383; HSD17
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF383; Polyclonal Antibody; ZNF383 (Zinc Finger Protein 383; HSD17); Anti -ZNF383 (Zinc Finger Protein 383; anti-ZNF383 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ZNF383.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYGNLVSMGLYTPKPQVISLLEQGKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDVLEYRSHLAKQLGYPNGHFSQEIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFSQNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSYLSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQHARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIHTGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEKPYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNK

• Applicable Applications for anti-ZNF383 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human ZNF383, aa1-475 (NP_689817.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF383 expression in transfected 293T cell line by ZNF383 polyclonal antibody. Lane 1: ZNF383 transfected lysate (52.25kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to ZNF383 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-ZNF383 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 23097321
• NCBI GeneID: 163087
• NCBI Accession #: NP_689817.1
• NCBI GenBank Nucleotide #: NM_152604.1
• UniProt Accession #: Q8NA42; Q6X2C7
• Molecular Weight: 54,613 Da
• NCBI Official Full Name: zinc finger protein 383
• NCBI Official Synonym Full Names: zinc finger protein 383
• NCBI Official Symbol: ZNF383
• NCBI Official Synonym Symbols: HSD17
• NCBI Protein Information: zinc finger protein 383
• UniProt Protein Name: Zinc finger protein 383
• Protein Family: Zinc finger protein
• UniProt Gene Name: ZNF383
• UniProt Entry Name: ZN383_HUMAN

Uniprot Description

ZNF383: May function as a transcriptional repressor, suppressing transcriptional activities mediated by MAPK signaling pathways. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent