Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Pancreas )

Rabbit anti-Dog, Human ZNF555 Polyclonal Antibody | anti-ZNF555 antibody

ZNF555 antibody - N-terminal region

Reactivity
Dog, Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF555; Polyclonal Antibody; ZNF555 antibody - N-terminal region; anti-ZNF555 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQEC
Sequence Length
628
Applicable Applications for anti-ZNF555 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF555
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Pancreas )

Immunohistochemistry (IHC) (Human Pancreas )

Western Blot (WB)

(WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)
Related Product Information for anti-ZNF555 antibody
This is a rabbit polyclonal antibody against ZNF555. It was validated on Western Blot and immunohistochemistry

Target Description: ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Product Categories/Family for anti-ZNF555 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
zinc finger protein 555 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 555
NCBI Official Symbol
ZNF555
NCBI Protein Information
zinc finger protein 555
UniProt Protein Name
Zinc finger protein 555
Protein Family
UniProt Gene Name
ZNF555
UniProt Entry Name
ZN555_HUMAN

Research Articles on ZNF555

Similar Products

Product Notes

The ZNF555 znf555 (Catalog #AAA3203015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF555 antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF555 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF555 znf555 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHLNLYKKIP PGVKQYEYNT YGKVFMHRRT SLKSPITVHT GHKPYQCQEC. It is sometimes possible for the material contained within the vial of "ZNF555, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.