Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF91 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit ZNF91 Polyclonal Antibody | anti-ZNF91 antibody

ZNF91 antibody - N-terminal region

Gene Names
ZNF91; HPF7; HTF10
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF91; Polyclonal Antibody; ZNF91 antibody - N-terminal region; anti-ZNF91 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HKIIHAGEKLYKCEECGKAFNRSSNLTIHKFIHTGEKPYKCEECGKAFNW
Sequence Length
1191
Applicable Applications for anti-ZNF91 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF91
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF91 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-ZNF91 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-ZNF91 antibody
This is a rabbit polyclonal antibody against ZNF91. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF91 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 36 C2H2-type zinc fingers and 1 KRAB domain. The function of the ZNF91 protein remains unknown. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Product Categories/Family for anti-ZNF91 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137kDa
NCBI Official Full Name
zinc finger protein 91 isoform 1
NCBI Official Synonym Full Names
zinc finger protein 91
NCBI Official Symbol
ZNF91
NCBI Official Synonym Symbols
HPF7; HTF10
NCBI Protein Information
zinc finger protein 91
UniProt Protein Name
Zinc finger protein 91
Protein Family
UniProt Gene Name
ZNF91
UniProt Entry Name
ZNF91_HUMAN

NCBI Description

The ZNF91 gene encodes a zinc finger protein of the KRAB (Kruppel-associated box) subfamily (Bellefroid et al., 1991, 1993 [PubMed 2023909] [PubMed 8467795]).[supplied by OMIM, May 2010]

Uniprot Description

ZNF91: Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing

Protein type: DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19p12

Cellular Component: nucleus

Molecular Function: DNA binding; zinc ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Research Articles on ZNF91

Similar Products

Product Notes

The ZNF91 znf91 (Catalog #AAA3208640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF91 antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF91 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF91 znf91 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HKIIHAGEKL YKCEECGKAF NRSSNLTIHK FIHTGEKPYK CEECGKAFNW. It is sometimes possible for the material contained within the vial of "ZNF91, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.