Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZN160Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ZNF160 Polyclonal Antibody | anti-ZNF160 antibody

ZNF160 Antibody - N-terminal region

Gene Names
ZNF160; F11; HZF5; KR18; HKr18
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF160; Polyclonal Antibody; ZNF160 Antibody - N-terminal region; anti-ZNF160 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDM
Sequence Length
818
Applicable Applications for anti-ZNF160 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN160
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZN160Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZN160Sample Type: Ovary Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZNF160 antibody
This is a rabbit polyclonal antibody against ZN160. It was validated on Western Blot

Target Description: The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Multiple transcript variants have been found for this gene.
Product Categories/Family for anti-ZNF160 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Synonym Full Names
zinc finger protein 160
NCBI Official Symbol
ZNF160
NCBI Official Synonym Symbols
F11; HZF5; KR18; HKr18
NCBI Protein Information
zinc finger protein 160
UniProt Protein Name
Zinc finger protein 160
Protein Family
UniProt Gene Name
ZNF160
UniProt Synonym Gene Names
KIAA1611; HKr18
UniProt Entry Name
ZN160_HUMAN

NCBI Description

The protein encoded by this gene is a Kruppel-related zinc finger protein which is characterized by the presence of an N-terminal repressor domain, the Kruppel-associated box (KRAB). The KRAB domain is a potent repressor of transcription; thus this protein may function in transcription regulation. Multiple transcript variants have been found for this gene. [provided by RefSeq, Apr 2016]

Uniprot Description

ZNF160: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; hemopoiesis

Research Articles on ZNF160

Similar Products

Product Notes

The ZNF160 znf160 (Catalog #AAA3210385) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF160 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF160 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF160 znf160 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVRLTFRDVA IEFSQEEWKC LDPAQRILYR DVMLENYWNL VSLGLCHFDM. It is sometimes possible for the material contained within the vial of "ZNF160, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.