Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Rabbit ZNF148 Polyclonal Antibody | anti-ZNF148 antibody

ZNF148 antibody - middle region

Gene Names
ZNF148; BERF-1; BFCOL1; GDACCF; ZBP-89; ZFP148; pHZ-52; HT-BETA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF148; Polyclonal Antibody; ZNF148 antibody - middle region; anti-ZNF148 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPF
Sequence Length
794
Applicable Applications for anti-ZNF148 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF148
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Placenta)
Related Product Information for anti-ZNF148 antibody
This is a rabbit polyclonal antibody against ZNF148. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF148 is involved in transcriptional regulation. ZNF148 represses the transcription of a number of genes including gastrin, stromelysin and enolase. ZNF148 binds to the G-rich box in the enhancer region of these genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
zinc finger protein 148 isoform a
NCBI Official Synonym Full Names
zinc finger protein 148
NCBI Official Symbol
ZNF148
NCBI Official Synonym Symbols
BERF-1; BFCOL1; GDACCF; ZBP-89; ZFP148; pHZ-52; HT-BETA
NCBI Protein Information
zinc finger protein 148
UniProt Protein Name
Zinc finger protein 148
Protein Family
UniProt Gene Name
ZNF148
UniProt Synonym Gene Names
ZBP89
UniProt Entry Name
ZN148_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. The encoded protein activates transcription of the T-cell receptor and intestinal alkaline phosphatase genes but represses transcription of the ornithine decarboxylase, vimentin, gastrin, stomelysin, and enolase genes. Increased expression of this gene results in decreased patient survival rates from colorectal cancer, while mutations in this gene have been associated with global developmental delay, hypoplastic corpus callosum, and dysmorphic facies. [provided by RefSeq, Feb 2017]

Uniprot Description

ZNF148: a transcription factor. Represses the transcription of a number of genes including gastrin, stromelysin and enolase. Binds to the G-rich box in the enhancer region of these genes. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; DNA-binding; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: nucleoplasm; Golgi apparatus

Molecular Function: protein binding; sequence-specific DNA binding; metal ion binding; double-stranded DNA binding

Biological Process: transcription from RNA polymerase II promoter; substantia nigra development; gamete generation; cellular defense response; protein complex assembly; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on ZNF148

Similar Products

Product Notes

The ZNF148 znf148 (Catalog #AAA3202120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF148 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF148 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF148 znf148 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHSFPFSGDE TNHASATSTQ DFLDQVTSQK KAEAQPVHQA YQMSSFEQPF. It is sometimes possible for the material contained within the vial of "ZNF148, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.