Western Blot (WB)
(WB Suggested Anti-ZNF146 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Rabbit ZNF146 Polyclonal Antibody | anti-ZNF146 antibody
ZNF146 antibody - middle region
Gene Names
ZNF146; OZF
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF146; Polyclonal Antibody; ZNF146 antibody - middle region; anti-ZNF146 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKA
Sequence Length
292
Applicable Applications for anti-ZNF146 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF146
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF146 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-ZNF146 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-ZNF146 antibody
This is a rabbit polyclonal antibody against ZNF146. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZNF146 (OZF) overexpression in tumours may alter the balance between hRap1 and other telomeric proteins; therefore OZF function may be linked to telomere regulation. ZNF146 is strongly overexpressed in many pancreas and colorectal cancers. Increased gene
Target Description: ZNF146 (OZF) overexpression in tumours may alter the balance between hRap1 and other telomeric proteins; therefore OZF function may be linked to telomere regulation. ZNF146 is strongly overexpressed in many pancreas and colorectal cancers. Increased gene
Product Categories/Family for anti-ZNF146 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
zinc finger protein OZF
NCBI Official Synonym Full Names
zinc finger protein 146
NCBI Official Symbol
ZNF146
NCBI Official Synonym Symbols
OZF
NCBI Protein Information
zinc finger protein OZF
UniProt Protein Name
Zinc finger protein OZF
Protein Family
UniProt Gene Name
ZNF146
UniProt Synonym Gene Names
OZF
Uniprot Description
ZNF146: Belongs to the krueppel C2H2-type zinc-finger protein family.
Protein type: C2H2-type zinc finger protein; DNA-binding
Chromosomal Location of Human Ortholog: 19q13.12
Cellular Component: cytosol; nucleolus; nucleus
Molecular Function: DNA binding; DNA binding transcription factor activity; heparin binding; zinc ion binding
Biological Process: regulation of transcription, DNA-templated
Research Articles on ZNF146
Similar Products
Product Notes
The ZNF146 znf146 (Catalog #AAA3202783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF146 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF146 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF146 znf146 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTEHEKIHIG EKPFKCSECG TAFGQKKYLI KHQNIHTGEK PYECNECGKA. It is sometimes possible for the material contained within the vial of "ZNF146, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
