Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ZBP1 AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit anti-Human ZBP1 Polyclonal Antibody | anti-ZBP1 antibody

ZBP1 antibody - middle region

Gene Names
ZBP1; DAI; DLM1; DLM-1; C20orf183
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZBP1; Polyclonal Antibody; ZBP1 antibody - middle region; anti-ZBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
Sequence Length
429
Applicable Applications for anti-ZBP1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ZBP1 AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-ZBP1 AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-ZBP1 antibody
This is a rabbit polyclonal antibody against ZBP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.
Product Categories/Family for anti-ZBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
Z-DNA-binding protein 1 isoform a
NCBI Official Synonym Full Names
Z-DNA binding protein 1
NCBI Official Symbol
ZBP1
NCBI Official Synonym Symbols
DAI; DLM1; DLM-1; C20orf183
NCBI Protein Information
Z-DNA-binding protein 1
UniProt Protein Name
Z-DNA-binding protein 1
Protein Family
UniProt Gene Name
ZBP1
UniProt Synonym Gene Names
C20orf183; DLM1
UniProt Entry Name
ZBP1_HUMAN

NCBI Description

This gene encodes a Z-DNA binding protein. The encoded protein plays a role in the innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

ZBP1: Participates in the detection by the host's innate immune system of DNA from viral, bacterial or even host origin. Plays a role in host defense against tumors and pathogens. Acts as a cytoplasmic DNA sensor which, when activated, induces the recruitment of TBK1 and IRF3 to its C-terminal region and activates the downstream interferon regulatory factor (IRF) and NF-kappa B transcription factors, leading to type-I interferon production. ZBP1-induced NF-kappaB activation probably involves the recruitment of the RHIM containing kinases RIPK1 and RIPK3. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q13.31

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: double-stranded RNA adenosine deaminase activity; protein binding; DNA binding; left-handed Z-DNA binding; RNA binding

Biological Process: metabolic process; positive regulation of interferon type I production; innate immune response

Research Articles on ZBP1

Similar Products

Product Notes

The ZBP1 zbp1 (Catalog #AAA3203281) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBP1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZBP1 zbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYRMKSRHLL DMDEQSKAWT IYRPEDSGRR AKSASIIYQH NPINMICQNG. It is sometimes possible for the material contained within the vial of "ZBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.