Western Blot (WB)
(Host: RabbitTarget Name: ZBED5Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human ZBED5 Polyclonal Antibody | anti-ZBED5 antibody
ZBED5 Antibody - N-terminal region
Gene Names
ZBED5; Buster1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZBED5; Polyclonal Antibody; ZBED5 Antibody - N-terminal region; anti-ZBED5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKK
Sequence Length
693
Applicable Applications for anti-ZBED5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBED5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZBED5Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZBED5Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZBED5 antibody
This is a rabbit polyclonal antibody against ZBED5. It was validated on Western Blot
Target Description: This gene is unusual in that its coding sequence is mostly derived from Charlie-like DNA transposon; however, it does not appear to be an active DNA transposon as it is not flanked by terminal inverted repeats. The encoded protein is conserved among the mammalian Laurasiatheria branch. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Target Description: This gene is unusual in that its coding sequence is mostly derived from Charlie-like DNA transposon; however, it does not appear to be an active DNA transposon as it is not flanked by terminal inverted repeats. The encoded protein is conserved among the mammalian Laurasiatheria branch. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-ZBED5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Synonym Full Names
zinc finger BED-type containing 5
NCBI Official Symbol
ZBED5
NCBI Official Synonym Symbols
Buster1
NCBI Protein Information
zinc finger BED domain-containing protein 5
UniProt Protein Name
Zinc finger BED domain-containing protein 5
Protein Family
UniProt Gene Name
ZBED5
UniProt Synonym Gene Names
Buster1
UniProt Entry Name
ZBED5_HUMAN
NCBI Description
This gene is unusual in that its coding sequence is mostly derived from Charlie-like DNA transposon; however, it does not appear to be an active DNA transposon as it is not flanked by terminal inverted repeats. The encoded protein is conserved among the mammalian Laurasiatheria branch. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2009]
Research Articles on ZBED5
Similar Products
Product Notes
The ZBED5 zbed5 (Catalog #AAA3219042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBED5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZBED5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZBED5 zbed5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRVKFISNSN KITFSKKPKR RKYDESYLSF GFTYFGNRDA PHAQCVLCKK. It is sometimes possible for the material contained within the vial of "ZBED5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
