Rabbit anti-Human CCR6 Polyclonal Antibody | anti-CCR6 antibody

CCR6 Rabbit pAb

Cat. Num. AAA9142219

• Gene Names: CCR6; BN-1; DCR2; DRY6; CCR-6; CD196; CKRL3; GPR29; CKR-L3; CMKBR6; GPRCY4; STRL22; CC-CKR-6; C-C CKR-6
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: CCR6; Polyclonal Antibody; CCR6 Rabbit pAb; BN-1; C-C CKR-6; CC-CKR-6; CCR-6; CD196; CKR-L3; CKRL3; CMKBR6; DCR2; DRY6; GPR29; GPRCY4; STRL22; anti-CCR6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

• Applicable Applications for anti-CCR6 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human CCR6 (NP_004358.2).
• Positive Samples: LO2
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of LO2 cells, using CCR6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-CCR6 antibody

Background: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha). This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene.

Product Categories/Family for anti-CCR6 antibody

Signal Transduction; G protein signaling; G-Protein-Coupled Receptors(GPCR); Research; Immunology & Inflammation; CDs; Research; Immunology & Inflammation; Cell Intrinsic Innate Immunity Signaling Pathway; Chemokines

NCBI and Uniprot Product Information

• NCBI GI #: 37188165
• NCBI GeneID: 1235
• NCBI Accession #: NP_113597.2
• NCBI GenBank Nucleotide #: NM_031409.3
• UniProt Accession #: P51684; P78553; Q92846; E1P5C6
• Molecular Weight: 42,494 Da
• NCBI Official Full Name: C-C chemokine receptor type 6
• NCBI Official Synonym Full Names: chemokine (C-C motif) receptor 6
• NCBI Official Symbol: CCR6
• NCBI Official Synonym Symbols: BN-1; DCR2; DRY6; CCR-6; CD196; CKRL3; GPR29; CKR-L3; CMKBR6; GPRCY4; STRL22; CC-CKR-6; C-C CKR-6
• NCBI Protein Information: C-C chemokine receptor type 6; LARC receptor; chemokine receptor-like 3; chemokine (C-C) receptor 6; G protein-coupled receptor 29; G-protein coupled receptor 29; seven-transmembrane receptor, lymphocyte, 22
• UniProt Protein Name: C-C chemokine receptor type 6
• Protein Family: C-C chemokine receptor
• UniProt Gene Name: CCR6
• UniProt Synonym Gene Names: CKRL3; CMKBR6; GPR29; STRL22; C-C CKR-6; CC-CKR-6; CCR-6; CKR-L3; GPRCY4
• UniProt Entry Name: CCR6_HUMAN

NCBI Description

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligand of this receptor is macrophage inflammatory protein 3 alpha (MIP-3 alpha). This receptor has been shown to be important for B-lineage maturation and antigen-driven B-cell differentiation, and it may regulate the migration and recruitment of dentritic and T cells during inflammatory and immunological responses. Alternatively spliced transcript variants that encode the same protein have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CCR6: Receptor for a C-C type chemokine. Binds to MIP-3- alpha/LARC and subsequently transduces a signal by increasing the intracellular calcium ions level. Belongs to the G-protein coupled receptor 1 family.

Protein type: Motility/polarity/chemotaxis; GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 6q27

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cellular defense response; innate immune response; dendritic cell chemotaxis; immune response; signal transduction; cell motility; chemotaxis; humoral immune response