Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANO9Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ANO9 Polyclonal Antibody | anti-ANO9 antibody

ANO9 Antibody - middle region

Gene Names
ANO9; PIG5; TP53I5; TMEM16J
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANO9; Polyclonal Antibody; ANO9 Antibody - middle region; anti-ANO9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYL
Sequence Length
483
Applicable Applications for anti-ANO9 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human ANO9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANO9Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANO9Sample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ANO9 antibody
This is a rabbit polyclonal antibody against ANO9. It was validated on Western Blot

Target Description: ANO9 does not exhibit calcium-activated chloride channel (CaCC) activity. It can inhibit the activity of ANO1.
Product Categories/Family for anti-ANO9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
anoctamin-9 isoform 1
NCBI Official Synonym Full Names
anoctamin 9
NCBI Official Symbol
ANO9
NCBI Official Synonym Symbols
PIG5; TP53I5; TMEM16J
NCBI Protein Information
anoctamin-9
UniProt Protein Name
Anoctamin-9
Protein Family
UniProt Gene Name
ANO9
UniProt Synonym Gene Names
PIG5; TMEM16J; TP53I5
UniProt Entry Name
ANO9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TMEM16 (anoctamin) family of proteins, some of which form integral membrane calcium-activated chloride channels. The function of the encoded protein has yet to be elucidated, although it may have channel-forming abilities and also may have phospholipid scramblase activity. This gene has been observed to be upregulated in stage II and III colorectal cancers. [provided by RefSeq, Dec 2016]

Uniprot Description

ANO9: May act as a calcium-activated chloride channel. Belongs to the anoctamin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Transporter; Transporter, ion channel; Channel, chloride; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: integral to membrane; plasma membrane; intracellular

Molecular Function: phospholipid scramblase activity; intracellular calcium activated chloride channel activity

Biological Process: chloride transport; lipid transport; transmembrane transport

Research Articles on ANO9

Similar Products

Product Notes

The ANO9 ano9 (Catalog #AAA3207461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANO9 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANO9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANO9 ano9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIIMGLKQTL SNCVEYLVPW VTHKCRSLRA SESGHLPRDP ELRDWRRNYL. It is sometimes possible for the material contained within the vial of "ANO9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.