Western Blot (WB)
(Host: RabbitTarget Name: TTC25Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human TTC25 Polyclonal Antibody | anti-TTC25 antibody
TTC25 Antibody - C-terminal region
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TTC25; Polyclonal Antibody; TTC25 Antibody - C-terminal region; anti-TTC25 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEY
Sequence Length
672
Applicable Applications for anti-TTC25 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TTC25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TTC25Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TTC25Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TTC25 antibody
This is a rabbit polyclonal antibody against TTC25. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TTC25 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
tetratricopeptide repeat protein 25 isoform 1
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 25
NCBI Official Symbol
TTC25
NCBI Protein Information
tetratricopeptide repeat protein 25
UniProt Protein Name
Tetratricopeptide repeat protein 25
Protein Family
UniProt Gene Name
TTC25
UniProt Synonym Gene Names
TPR repeat protein 25
UniProt Entry Name
TTC25_HUMAN
NCBI Description
This gene encodes a tetratricopeptide repeat domain-containing protein that localizes to ciliary axonmenes and plays a role in the docking of the outer dynein arm to cilia. Mutations in this gene cause severely reduced ciliary motility and the disorder CILD35 (ciliary dyskinesia,primary, 35). Primary ciliary dyskinesia is often associated with recurrent respiratory infections, immotile spermatozoa, and situs inversus; an inversion in left-right body symmetry. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017]
Research Articles on TTC25
Similar Products
Product Notes
The TTC25 ttc25 (Catalog #AAA3218026) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TTC25 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TTC25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TTC25 ttc25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLSGEFSRQE PEELKKLSEV GRREPEELGK TQFGEIGETK KTGNEMEKEY. It is sometimes possible for the material contained within the vial of "TTC25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
