Immunohistochemistry (IHC)
(Human kidney )
Rabbit ZA20D3 Polyclonal Antibody | anti-ZFAND6 antibody
ZA20D3 antibody - middle region
Gene Names
ZFAND6; AWP1; ZA20D3; ZFAND5B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ZA20D3; Polyclonal Antibody; ZA20D3 antibody - middle region; anti-ZFAND6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHR
Sequence Length
208
Applicable Applications for anti-ZFAND6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZA20D3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human kidney )
Immunohistochemistry (IHC)
(Human kidney )
Western Blot (WB)
(WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-ZFAND6 antibody
This is a rabbit polyclonal antibody against ZA20D3. It was validated on Western Blot and immunohistochemistry
Target Description: ZA20D3 is a zinc-finger protein located on chromosome 15.
Target Description: ZA20D3 is a zinc-finger protein located on chromosome 15.
Product Categories/Family for anti-ZFAND6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
AN1-type zinc finger protein 6 isoform a
NCBI Official Synonym Full Names
zinc finger AN1-type containing 6
NCBI Official Symbol
ZFAND6
NCBI Official Synonym Symbols
AWP1; ZA20D3; ZFAND5B
NCBI Protein Information
AN1-type zinc finger protein 6
UniProt Protein Name
AN1-type zinc finger protein 6
Protein Family
UniProt Gene Name
ZFAND6
UniProt Synonym Gene Names
AWP1; ZA20D3
Uniprot Description
Involved in regulation of TNF-alpha induced NF-kappa-B activation and apoptosis. Involved in modulation of 'Lys-48'-linked polyubiquitination status of TRAF2 and decreases association of TRAF2 with RIPK1. Required for PTS1 target sequence-dependent protein import into peroxisomes and PEX5 stability; may cooperate with PEX6. In vitro involved in PEX5 export from the cytosol to peroxisomes ().
Research Articles on ZFAND6
Similar Products
Product Notes
The ZFAND6 zfand6 (Catalog #AAA3202072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZA20D3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZA20D3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZFAND6 zfand6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDTAQQPSEE QSKSLEKPKQ KKNRCFMCRK KVGLTGFECR CGNVYCGVHR. It is sometimes possible for the material contained within the vial of "ZA20D3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
