Immunohistochemistry (IHC)
(Human Spleen )
Rabbit RCOR3 Polyclonal Antibody | anti-RCOR3 antibody
RCOR3 antibody - N-terminal region
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RCOR3; Polyclonal Antibody; RCOR3 antibody - N-terminal region; anti-RCOR3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIA
Sequence Length
495
Applicable Applications for anti-RCOR3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Spleen )
Immunohistochemistry (IHC)
(Human Spleen )
Western Blot (WB)
(WB Suggested Anti-RCOR3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateRCOR3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-RCOR3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateRCOR3 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-RCOR3 antibody
This is a rabbit polyclonal antibody against RCOR3. It was validated on Western Blot and immunohistochemistry
Target Description: RCOR3 is a REST corepressor 3 protein located on chromosome 1.
Target Description: RCOR3 is a REST corepressor 3 protein located on chromosome 1.
Product Categories/Family for anti-RCOR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
REST corepressor 3 isoform d
NCBI Official Synonym Full Names
REST corepressor 3
NCBI Official Symbol
RCOR3
NCBI Protein Information
REST corepressor 3
UniProt Protein Name
REST corepressor 3
Protein Family
UniProt Gene Name
RCOR3
UniProt Synonym Gene Names
KIAA1343
UniProt Entry Name
RCOR3_HUMAN
Research Articles on RCOR3
Similar Products
Product Notes
The RCOR3 rcor3 (Catalog #AAA3201877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RCOR3 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RCOR3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RCOR3 rcor3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRVGAEYQAR IPEFDPGATK YTDKDNGGML VWSPYHSIPD AKLDEYIAIA. It is sometimes possible for the material contained within the vial of "RCOR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
