Mouse anti-Human PRKAG2 Monoclonal Antibody | anti-PRKAG2 antibody

PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2, AMPK gamma2, AMPK Subunit gamma-2, H91620p,CMH6, H91620p, WPWS) (FITC)

Cat. Num. AAA6149039

• Gene Names: PRKAG2; AAKG; CMH6; WPWS; AAKG2; H91620p
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PRKAG2; Monoclonal Antibody; PRKAG2 (5'-AMP-activated Protein Kinase Subunit gamma-2; AMPK gamma2; AMPK Subunit gamma-2; H91620p; CMH6; WPWS) (FITC); anti-PRKAG2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3C4
• Specificity: Recognizes human PRKAG2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-PRKAG2 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa191-300 from human PRKAG2 (AAH20540) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AFMKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKAG2 expression in transfected 293T cell line by PRKAG2 monoclonal antibody. Lane 1: PRKAG2 transfected lysate (37.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PRKAG2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged PRKAG2 is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-PRKAG2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 18088230
• NCBI GeneID: 51422
• Molecular Weight: 58,439 Da
• NCBI Official Full Name: Homo sapiens protein kinase, AMP-activated, gamma 2 non-catalytic subunit, mRNA
• NCBI Official Synonym Full Names: protein kinase AMP-activated non-catalytic subunit gamma 2
• NCBI Official Symbol: PRKAG2
• NCBI Official Synonym Symbols: AAKG; CMH6; WPWS; AAKG2; H91620p
• NCBI Protein Information: 5'-AMP-activated protein kinase subunit gamma-2
• Protein Family: 5'-AMP-activated protein kinase

NCBI Description

AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMPK is an important energy-sensing enzyme that monitors cellular energy status and functions by inactivating key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This gene is a member of the AMPK gamma subunit family. Mutations in this gene have been associated with Wolff-Parkinson-White syndrome, familial hypertrophic cardiomyopathy, and glycogen storage disease of the heart. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jan 2015]