Western Blot (WB)
(Host: RabbitTarget Name: YTHDF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlYTHDF2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit YTHDF2 Polyclonal Antibody | anti-YTHDF2 antibody
YTHDF2 Antibody - C-terminal region
Gene Names
YTHDF2; CAHL; HGRG8; NY-REN-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
YTHDF2; Polyclonal Antibody; YTHDF2 Antibody - C-terminal region; anti-YTHDF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Sequence Length
579
Applicable Applications for anti-YTHDF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human YTHDF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: YTHDF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlYTHDF2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(Host: RabbitTarget Name: YTHDF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlYTHDF2 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-YTHDF2 antibody
This is a rabbit polyclonal antibody against YTHDF2. It was validated on Western Blot
Target Description: This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosme 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene.
Target Description: This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosme 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene.
Product Categories/Family for anti-YTHDF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
YTH domain-containing family protein 2 isoform 1
NCBI Official Synonym Full Names
YTH N6-methyladenosine RNA binding protein 2
NCBI Official Symbol
YTHDF2
NCBI Official Synonym Symbols
CAHL; HGRG8; NY-REN-2
NCBI Protein Information
YTH domain-containing family protein 2
UniProt Protein Name
YTH domain-containing family protein 2
Protein Family
UniProt Gene Name
YTHDF2
UniProt Synonym Gene Names
HGRG8
UniProt Entry Name
YTHD2_HUMAN
NCBI Description
This gene encodes a member of the YTH (YT521-B homology) superfamily containing YTH domain. The YTH domain is typical for the eukaryotes and is particularly abundant in plants. The YTH domain is usually located in the middle of the protein sequence and may function in binding to RNA. In addition to a YTH domain, this protein has a proline rich region which may be involved in signal transduction. An Alu-rich domain has been identified in one of the introns of this gene, which is thought to be associated with human longevity. In addition, reciprocal translocations between this gene and the Runx1 (AML1) gene on chromosome 21 has been observed in patients with acute myeloid leukemia. This gene was initially mapped to chromosome 14, which was later turned out to be a pseudogene. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Oct 2012]
Research Articles on YTHDF2
Similar Products
Product Notes
The YTHDF2 ythdf2 (Catalog #AAA3217656) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YTHDF2 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's YTHDF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the YTHDF2 ythdf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEVPLEKAKQ VLKIIASYKH TTSIFDDFSH YEKRQEEEES VKKERQGRGK. It is sometimes possible for the material contained within the vial of "YTHDF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
