Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WIPF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlWIPF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit WIPF2 Polyclonal Antibody | anti-WIPF2 antibody

WIPF2 Antibody - C-terminal region

Gene Names
WIPF2; WICH; WIRE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WIPF2; Polyclonal Antibody; WIPF2 Antibody - C-terminal region; anti-WIPF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVR
Sequence Length
290
Applicable Applications for anti-WIPF2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN WIPF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WIPF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlWIPF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (Host: RabbitTarget Name: WIPF2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlWIPF2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-WIPF2 antibody
This is a rabbit polyclonal antibody against WIPF2. It was validated on Western Blot

Target Description: This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.
Product Categories/Family for anti-WIPF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
WAS/WASL-interacting protein family member 2
NCBI Official Synonym Full Names
WAS/WASL interacting protein family member 2
NCBI Official Symbol
WIPF2
NCBI Official Synonym Symbols
WICH; WIRE
NCBI Protein Information
WAS/WASL-interacting protein family member 2
UniProt Protein Name
WAS/WASL-interacting protein family member 2
UniProt Gene Name
WIPF2
UniProt Synonym Gene Names
WICH; WIRE
UniProt Entry Name
WIPF2_HUMAN

NCBI Description

This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. [provided by RefSeq, Jul 2008]

Uniprot Description

WIRE: Plays an active role in the formation of cell surface protrusions downstream of activated PDGFB receptors. Plays an important role in actin-microspike formation through cooperation with WASL. May cooperate with WASP and WASL to induce mobilization and reorganization of the actin filament system. Belongs to the verprolin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: cytoskeleton; cytosol

Molecular Function: protein binding; actin binding

Biological Process: innate immune response

Research Articles on WIPF2

Similar Products

Product Notes

The WIPF2 wipf2 (Catalog #AAA3210850) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WIPF2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WIPF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WIPF2 wipf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPPPPYRMHG SEPPSRGKPP PPPSRTPAGP PPPPPPPLRN GHRDSITTVR. It is sometimes possible for the material contained within the vial of "WIPF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.