Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using WDHD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit anti-Human WDHD1 Polyclonal Antibody | anti-WDHD1 antibody
WDHD1 Polyclonal Antibody
Gene Names
WDHD1; AND1; CTF4; AND-1; CHTF4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
WDHD1; Polyclonal Antibody; WDHD1 Polyclonal Antibody; AND-1; AND1; CHTF4; CTF4; anti-WDHD1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EEEEEEDFRKKLNAGYSNTATEWSQPRFRNQVEEDAEDSGEADDEEKPEIHKPGQNSFSKSTNSSDVSAKSGAVTFSSQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRK
Sequence Length
1006
Applicable Applications for anti-WDHD1 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human WDHD1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleoplasm
Positive Samples
LO2, U-251MG, A-431, HeLa, Jurkat
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using WDHD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using WDHD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-WDHD1 antibody
The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.
Product Categories/Family for anti-WDHD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 112kDa; 125kDa
Observed: 135kDa
Observed: 135kDa
NCBI Official Full Name
WD repeat and HMG-box DNA-binding protein 1 isoform 2
NCBI Official Synonym Full Names
WD repeat and HMG-box DNA binding protein 1
NCBI Official Symbol
WDHD1
NCBI Official Synonym Symbols
AND1; CTF4; AND-1; CHTF4
NCBI Protein Information
WD repeat and HMG-box DNA-binding protein 1
UniProt Protein Name
WD repeat and HMG-box DNA-binding protein 1
Protein Family
UniProt Gene Name
WDHD1
UniProt Synonym Gene Names
AND1; And-1
NCBI Description
The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Uniprot Description
Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication.
Research Articles on WDHD1
Similar Products
Product Notes
The WDHD1 wdhd1 (Catalog #AAA9135382) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDHD1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDHD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the WDHD1 wdhd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEEEEEDFRK KLNAGYSNTA TEWSQPRFRN QVEEDAEDSG EADDEEKPEI HKPGQNSFSK STNSSDVSAK SGAVTFSSQG RVNPFKVSAS SKEPAMSMNS ARSTNILDNM GKSSKKSTAL SRTTNNEKSP IIKPLIPKPK PKQASAASYF QKRNSQTNKT EEVKEENLKN VLSETPAICP PQNTENQRPK TGFQMWLEEN RSNILSDNPD FSDEADIIKE GMIRFRVLST EERKVWANKA KGETASEGTE AKKRK. It is sometimes possible for the material contained within the vial of "WDHD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
