Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VTI1BSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human VTI1B Polyclonal Antibody | anti-VTI1B antibody

VTI1B Antibody - middle region

Gene Names
VTI1B; VTI1; VTI2; VTI1L; v-SNARE; vti1-rp1; VTI1-LIKE
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VTI1B; Polyclonal Antibody; VTI1B Antibody - middle region; anti-VTI1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENE
Sequence Length
232
Applicable Applications for anti-VTI1B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human VTI1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VTI1BSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VTI1BSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-VTI1B antibody
V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence.
Product Categories/Family for anti-VTI1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
vesicle transport through interaction with t-SNAREs homolog 1B
NCBI Official Synonym Full Names
vesicle transport through interaction with t-SNAREs 1B
NCBI Official Symbol
VTI1B
NCBI Official Synonym Symbols
VTI1; VTI2; VTI1L; v-SNARE; vti1-rp1; VTI1-LIKE
NCBI Protein Information
vesicle transport through interaction with t-SNAREs homolog 1B
UniProt Protein Name
Vesicle transport through interaction with t-SNAREs homolog 1B
UniProt Gene Name
VTI1B
UniProt Synonym Gene Names
VTI1; VTI1L; VTI1L1; VTI2
UniProt Entry Name
VTI1B_HUMAN

Uniprot Description

VTI1B: V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence. Belongs to the VTI1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: SNARE complex; Golgi apparatus; endoplasmic reticulum membrane; recycling endosome; synaptic vesicle; cell soma; intracellular membrane-bound organelle; late endosome membrane; lysosomal membrane; perinuclear region of cytoplasm; cytoplasm; integral to membrane; vesicle

Molecular Function: SNAP receptor activity; SNARE binding; chloride channel inhibitor activity

Biological Process: vesicle-mediated transport; cell proliferation; intra-Golgi vesicle-mediated transport; ER to Golgi vesicle-mediated transport; autophagic vacuole fusion; Golgi to vacuole transport; vesicle fusion with Golgi apparatus; protein targeting to vacuole; retrograde transport, endosome to Golgi; vesicle docking during exocytosis

Research Articles on VTI1B

Similar Products

Product Notes

The VTI1B vti1b (Catalog #AAA3219864) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VTI1B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VTI1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VTI1B vti1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSFRNPMMSK LRNYRKDLAK LHREVRSTPL TATPGGRGDM KYGIYAVENE. It is sometimes possible for the material contained within the vial of "VTI1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.