Western Blot (WB)
(WB Suggested Anti-VNN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)
Rabbit VNN3 Polyclonal Antibody | anti-VNN3 antibody
VNN3 antibody - N-terminal region
Gene Names
VNN3; HSA238982
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VNN3; Polyclonal Antibody; VNN3 antibody - N-terminal region; anti-VNN3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY
Sequence Length
274
Applicable Applications for anti-VNN3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VNN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-VNN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-VNN3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Thymus)
Related Product Information for anti-VNN3 antibody
This is a rabbit polyclonal antibody against VNN3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs.
Target Description: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. The open reading frame is disrupted by a frameshift, and all splice variants that have been described are candidates for nonsense-mediated decay (NMD). Consequently, it is unlikely that this gene expresses a protein in vivo, so it is classified as a pseudogene. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs.
Product Categories/Family for anti-VNN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Synonym Full Names
vanin 3
NCBI Official Symbol
VNN3
NCBI Official Synonym Symbols
HSA238982
NCBI Protein Information
vascular non-inflammatory molecule 3
UniProt Protein Name
Vascular non-inflammatory molecule 3
Protein Family
UniProt Gene Name
VNN3
UniProt Synonym Gene Names
Vanin-3
UniProt Entry Name
VNN3_HUMAN
NCBI Description
This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq, Apr 2014]
Uniprot Description
VNN3: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. Belongs to the CN hydrolase family. BTD/VNN subfamily. Induced by Th17/Th1 type cytokines, but not by Th2-type. 8 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, GPI anchor; EC 3.5.1.92
Chromosomal Location of Human Ortholog: 6q23.2
Cellular Component: plasma membrane
Molecular Function: pantetheine hydrolase activity
Biological Process: nitrogen compound metabolic process
Research Articles on VNN3
Similar Products
Product Notes
The VNN3 vnn3 (Catalog #AAA3207509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VNN3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's VNN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VNN3 vnn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VILPNRTETP VSKEEALLLM NKNIDVLEKA VKLAAKQGAH IIVTPEDGIY. It is sometimes possible for the material contained within the vial of "VNN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
