Mouse anti-Human KLF8 Monoclonal Antibody | anti-KLF8 antibody

KLF8 (Krueppel-like Factor 8, Basic Krueppel-like Factor 3, Zinc Finger Protein 741, BKLF3, ZNF741) (FITC)

Cat. Num. AAA6147920

• Gene Names: KLF8; BKLF3; ZNF741
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLF8; Monoclonal Antibody; KLF8 (Krueppel-like Factor 8; Basic Krueppel-like Factor 3; Zinc Finger Protein 741; BKLF3; ZNF741) (FITC); anti-KLF8 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E10
• Specificity: Recognizes human KLF8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 9096

• Applicable Applications for anti-KLF8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-99 from KLF8 (NP_009181) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of KLF8 expression in transfected 293T cell line by KLF8 monoclonal antibody Lane 1: KLF8 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KLF8 is 3ng/ml as a capture antibody.)

Related Product Information for anti-KLF8 antibody

Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G1 phase as a downstream target of focal adhesion kinase (FAK).

Product Categories/Family for anti-KLF8 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1022943256
• NCBI GeneID: 11279
• NCBI Accession #: NM_007250.5
• NCBI GenBank Nucleotide #: NM_007250
• UniProt Accession #: O95600
• NCBI Official Full Name: Homo sapiens Kruppel like factor 8 (KLF8), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: Kruppel like factor 8
• NCBI Official Symbol: KLF8
• NCBI Official Synonym Symbols: BKLF3; ZNF741
• NCBI Protein Information: Krueppel-like factor 8
• UniProt Protein Name: Krueppel-like factor 8
• Protein Family: Krueppel-like factor
• UniProt Gene Name: KLF8
• UniProt Synonym Gene Names: BKLF3; ZNF741
• UniProt Entry Name: KLF8_HUMAN

NCBI Description

This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

Uniprot Description

KLF8: Transcriptional repressor and activator. Binds to CACCC- boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK). Belongs to the Sp1 C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xp11.21

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent