Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAPNS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Rabbit CAPNS1 Polyclonal Antibody | anti-CAPNS1 antibody

CAPNS1 antibody - middle region

Gene Names
CAPNS1; CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAPNS1; Polyclonal Antibody; CAPNS1 antibody - middle region; anti-CAPNS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL
Sequence Length
268
Applicable Applications for anti-CAPNS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAPNS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAPNS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-CAPNS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Related Product Information for anti-CAPNS1 antibody
This is a rabbit polyclonal antibody against CAPNS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes. This gene encodes a small subunit common to both calpain I and II and is associated with myotonic dystrophy. Two transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-CAPNS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
826
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
calpain small subunit 1 isoform 1
NCBI Official Synonym Full Names
calpain small subunit 1
NCBI Official Symbol
CAPNS1
NCBI Official Synonym Symbols
CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
NCBI Protein Information
calpain small subunit 1
UniProt Protein Name
Calpain small subunit 1
Protein Family
UniProt Gene Name
CAPNS1
UniProt Synonym Gene Names
CAPN4; CAPNS; CSS1; CANP small subunit; CDPS
UniProt Entry Name
CPNS1_HUMAN

NCBI Description

This gene is a member of the calpain small subunit family. Calpains are calcium-dependent cysteine proteinases that are widely distributed in mammalian cells. Calpains operate as heterodimers, comprising a specific large catalytic subunit (calpain 1 subunit in Calpain I, and calpain 2 subunit in Calpain II), and a common small regulatory subunit encoded by this gene. This encoded protein is essential for the stability and function of both calpain heterodimers, whose proteolytic activities influence various cellular functions including apoptosis, proliferation, migration, adhesion, and autophagy. Calpains have been implicated in neurodegenerative processes, such as myotonic dystrophy. A pseudogene of this gene has been defined on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

CAPNS1: Regulatory subunit of the calcium-regulated non- lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.

Protein type: Protease; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; positive regulation of cell proliferation; proteolysis

Research Articles on CAPNS1

Similar Products

Product Notes

The CAPNS1 capns1 (Catalog #AAA3213886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAPNS1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CAPNS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAPNS1 capns1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRYSDESGNM DFDNFISCLV RLDAMFRAFK SLDKDGTGQI QVNIQEWLQL. It is sometimes possible for the material contained within the vial of "CAPNS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.