Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VAMP4 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Rabbit anti-Human VAMP4 Polyclonal Antibody | anti-VAMP4 antibody

VAMP4 Antibody - N-terminal region

Gene Names
VAMP4; VAMP-4; VAMP24
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VAMP4; Polyclonal Antibody; VAMP4 Antibody - N-terminal region; anti-VAMP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKS
Sequence Length
141
Applicable Applications for anti-VAMP4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VAMP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VAMP4 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)

Western Blot (WB) (WB Suggested Anti-VAMP4 antibody Titration: 1 ug/mLSample Type: Human Fetal Liver)
Related Product Information for anti-VAMP4 antibody
This is a rabbit polyclonal antibody against VAMP4. It was validated on Western Blot

Target Description: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport.
Product Categories/Family for anti-VAMP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 kDa
NCBI Official Full Name
vesicle-associated membrane protein 4 isoform 1
NCBI Official Synonym Full Names
vesicle associated membrane protein 4
NCBI Official Symbol
VAMP4
NCBI Official Synonym Symbols
VAMP-4; VAMP24
NCBI Protein Information
vesicle-associated membrane protein 4
UniProt Protein Name
Vesicle-associated membrane protein 4
UniProt Gene Name
VAMP4
UniProt Synonym Gene Names
VAMP-4
UniProt Entry Name
VAMP4_HUMAN

NCBI Description

Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. This protein may play a role in trans-Golgi network-to-endosome transport. [provided by RefSeq, Jul 2008]

Uniprot Description

VAMP4: Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule. Belongs to the synaptobrevin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24-q25

Cellular Component: SNARE complex; Golgi membrane; Golgi apparatus; cell surface; lysosome; integral to membrane; trans-Golgi network; endosome

Molecular Function: SNAP receptor activity; SNARE binding

Biological Process: regulation of Golgi to plasma membrane protein transport; ER to Golgi vesicle-mediated transport; exocytosis; Golgi to plasma membrane protein transport; microtubule cytoskeleton organization and biogenesis

Research Articles on VAMP4

Similar Products

Product Notes

The VAMP4 vamp4 (Catalog #AAA3219627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAMP4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAMP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VAMP4 vamp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGPSGPRFGP RNDKIKHVQN QVDEVIDVMQ ENITKVIERG ERLDELQDKS. It is sometimes possible for the material contained within the vial of "VAMP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.