Rabbit USP7 Polyclonal Antibody | anti-USP7 antibody

USP7 antibody - middle region

Cat. Num. AAA3214167

• Gene Names: USP7; TEF1; HAUSP
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: USP7; Polyclonal Antibody; USP7 antibody - middle region; anti-USP7 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDI
• Sequence Length: 1102

• Applicable Applications for anti-USP7 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP7
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RatTarget Name: USP7Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-USP7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: A549 cell lysate)

Related Product Information for anti-USP7 antibody

This is a rabbit polyclonal antibody against USP7. It was validated on Western Blot

Target Description: USP7 is a hydrolase that deubiquitinates target proteins such as FOXO4, TP53, MDM2, PTEN and DAXX. Together with DAXX, USP7 prevents MDM2 self-ubiquitination and enhances the E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and proteasomal degradation. USP7 deubiquitinates TP53 and MDM2 and strongly stabilizes TP53 even in the presence of excess MDM2, and also induces TP53-dependent cell growth repression and apoptosis. Deubiquitination of FOXO4 in presence of hydrogen peroxide is not dependent on TP53 and inhibits FOXO4-induced transcriptional activity. In association with DAXX, USP7 is involved in the deubiquitination and translocation of PTEN from the nucleus to the cytoplasm, both processes that are counteracted by PML. USP7 is involved in cell proliferation during early embryonic development. USP7 contributes to the overall stabilization and trans-activation capability of the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110 during HSV-1 infection.

Product Categories/Family for anti-USP7 antibody

Polyclonal; Transcription Regulation; Cell Biology; E3 & Ubiquitin; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 150378533
• NCBI GeneID: 7874
• NCBI Accession #: NP_003461
• NCBI GenBank Nucleotide #: NM_003470
• UniProt Accession #: Q93009
• Molecular Weight: 128kDa
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 7 isoform 1
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 7
• NCBI Official Symbol: USP7
• NCBI Official Synonym Symbols: TEF1; HAUSP
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 7
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 7
• UniProt Gene Name: USP7
• UniProt Synonym Gene Names: HAUSP
• UniProt Entry Name: UBP7_HUMAN

NCBI Description

The protein encoded by this gene belongs to the peptidase C19 family, which includes ubiquitinyl hydrolases. This protein deubiquitinates target proteins such as p53 (a tumor suppressor protein) and WASH (essential for endosomal protein recycling), and regulates their activities by counteracting the opposing ubiquitin ligase activity of proteins such as HDM2 and TRIM27, involved in the respective process. Mutations in this gene have been implicated in a neurodevelopmental disorder. [provided by RefSeq, Mar 2016]

Uniprot Description

USP7: an enzyme that removes ubiquitin from its protein substrates. Binds to the herpes virus protein VMW110 that may therefore modulate its substrate specificity or activity to stabilize viral proteins. Regulates MDM2 and has a dynamic role in the p53-MDM2 pathway. Is reported to deubiquitinate and stabilize p53.

Protein type: Ubiquitin-specific protease; Protease; EC 3.4.19.12; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nuclear body; PML body; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein binding; p53 binding; cysteine-type endopeptidase activity; ubiquitin protein ligase binding; ubiquitin-specific protease activity; transcription factor binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; maintenance of DNA methylation; viral reproduction; regulation of transcription factor activity; inhibition of NF-kappaB transcription factor; transcription-coupled nucleotide-excision repair; multicellular organismal development; histone deubiquitination