Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Upp2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Upp2 Polyclonal Antibody | anti-UPP2 antibody

Upp2 antibody - C-terminal region

Gene Names
Upp2; UP2; UPASE2; AI266885; UDRPASE2; 1700124F02Rik
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Upp2; Polyclonal Antibody; Upp2 antibody - C-terminal region; anti-UPP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG
Sequence Length
320
Applicable Applications for anti-UPP2 antibody
Western Blot (WB)
Homology
Cow: 93%; Goat: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Upp2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Upp2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-UPP2 antibody
This is a rabbit polyclonal antibody against Upp2. It was validated on Western Blot

Target Description: Upp2 catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
Product Categories/Family for anti-UPP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
uridine phosphorylase 2 isoform 3
NCBI Official Synonym Full Names
uridine phosphorylase 2
NCBI Official Symbol
Upp2
NCBI Official Synonym Symbols
UP2; UPASE2; AI266885; UDRPASE2; 1700124F02Rik
NCBI Protein Information
uridine phosphorylase 2
UniProt Protein Name
Uridine phosphorylase 2
Protein Family
UniProt Gene Name
Upp2
UniProt Synonym Gene Names
UPase 2; UrdPase 2; L-UrdPase

Uniprot Description

UPP2: Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1- phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates. Belongs to the PNP/UDP phosphorylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.2.3; Nucleotide Metabolism - pyrimidine; Phosphorylase; Transferase; Xenobiotic Metabolism - drug metabolism - other enzymes

Chromosomal Location of Human Ortholog: 2|2 C1.1

Cellular Component: cytoplasm; type III intermediate filament

Molecular Function: catalytic activity; transferase activity; transferase activity, transferring glycosyl groups; transferase activity, transferring pentosyl groups; uridine phosphorylase activity

Biological Process: nucleoside metabolic process; nucleotide catabolic process

Similar Products

Product Notes

The UPP2 upp2 (Catalog #AAA3209326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Upp2 antibody - C-terminal region reacts with Cow, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Upp2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UPP2 upp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SREIPNVPTL IGHTMCTYDF YEGQGRLDGA LCSFSREKKL DYLKRAYRAG. It is sometimes possible for the material contained within the vial of "Upp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.