Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UPF3B antibody (MBS5302217) used at 1 ug/ml to detect target protein.)

Rabbit UPF3B Polyclonal Antibody | anti-UPF3B antibody

UPF3B antibody

Gene Names
UPF3B; MRX62; UPF3X; HUPF3B; MRXS14; RENT3B
Applications
Western Blot
Purity
Affinity purified
Synonyms
UPF3B; Polyclonal Antibody; UPF3B antibody; Polyclonal UPF3B; Anti-UPF3B; Upf3 Regulator Of Nonsense Transcripts Homolog B; RENT3B; UPFB 3; MRXS14; HUPF3B; UPFB-3; UPF3X; anti-UPF3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UPF3B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
218
Applicable Applications for anti-UPF3B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.
Cross-Reactivity
Human
Immunogen
UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(UPF3B antibody (MBS5302217) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (UPF3B antibody (MBS5302217) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-UPF3B antibody
Rabbit polyclonal UPF3B antibody
Product Categories/Family for anti-UPF3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
58 kDa (MW of target protein)
NCBI Official Full Name
UPF3B protein
NCBI Official Synonym Full Names
UPF3 regulator of nonsense transcripts homolog B (yeast)
NCBI Official Symbol
UPF3B
NCBI Official Synonym Symbols
MRX62; UPF3X; HUPF3B; MRXS14; RENT3B
NCBI Protein Information
regulator of nonsense transcripts 3B
UniProt Protein Name
Regulator of nonsense transcripts 3B
UniProt Gene Name
UPF3B
UniProt Synonym Gene Names
RENT3B; UPF3X; hUpf3B; hUpf3p-X
UniProt Entry Name
REN3B_HUMAN

NCBI Description

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UPF3B: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2- UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation; the function is indepenedent of association with UPF2 and components of the EJC core. Defects in UPF3B are the cause of mental retardation syndromic X-linked type 14 (MRXS14). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRXS14 patients manifest mental retardation associated with other variable signs such as autistic features, slender build, poor musculature, long, thin face, high-arched palate, high nasal bridge, and pectus deformities. Belongs to the RENT3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: mRNA binding; protein binding; nucleotide binding; nucleocytoplasmic transporter activity

Biological Process: nuclear mRNA splicing, via spliceosome; transcription from RNA polymerase II promoter; mRNA export from nucleus; positive regulation of translation; RNA splicing; mRNA catabolic process, nonsense-mediated decay; gene expression; mRNA 3'-end processing; termination of RNA polymerase II transcription

Disease: Mental Retardation, X-linked, Syndromic 14

Research Articles on UPF3B

Similar Products

Product Notes

The UPF3B upf3b (Catalog #AAA5302217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UPF3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the UPF3B upf3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UPF3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.