Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit UNC5A Polyclonal Antibody | anti-UNC5A antibody

UNC5A antibody - middle region

Gene Names
UNC5A; UNC5H1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UNC5A; Polyclonal Antibody; UNC5A antibody - middle region; anti-UNC5A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT
Sequence Length
842
Applicable Applications for anti-UNC5A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UNC5A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-UNC5A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-UNC5A antibody
This is a rabbit polyclonal antibody against UNC5A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C.UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM].
Product Categories/Family for anti-UNC5A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
netrin receptor UNC5A
NCBI Official Synonym Full Names
unc-5 netrin receptor A
NCBI Official Symbol
UNC5A
NCBI Official Synonym Symbols
UNC5H1
NCBI Protein Information
netrin receptor UNC5A
UniProt Protein Name
Netrin receptor UNC5A
Protein Family
UniProt Gene Name
UNC5A
UniProt Synonym Gene Names
KIAA1976; UNC5H1
UniProt Entry Name
UNC5A_HUMAN

NCBI Description

UNC5A belongs to a family of netrin-1 (MIM 601614) receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons. For more information on UNC5 proteins, see UNC5C (MIM 603610).[supplied by OMIM, Apr 2004]

Uniprot Description

UNC5A: Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. Belongs to the unc-5 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: integral to membrane; intrinsic to plasma membrane; lipid raft; plasma membrane

Biological Process: anterior/posterior axon guidance; apoptosis; axon guidance; neurite development; programmed cell death

Research Articles on UNC5A

Similar Products

Product Notes

The UNC5A unc5a (Catalog #AAA3209881) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UNC5A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UNC5A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UNC5A unc5a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYCRKKEGLD SDVADSSILT SGFQPVSIKP SKADNPHLLT IQPDLSTTTT. It is sometimes possible for the material contained within the vial of "UNC5A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.