Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Uchl1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)

Rabbit UCHL1 Polyclonal Antibody | anti-UCHL1 antibody

UCHL1 Antibody - middle region

Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UCHL1; Polyclonal Antibody; UCHL1 Antibody - middle region; anti-UCHL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEG
Sequence Length
223
Applicable Applications for anti-UCHL1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat UCHL1.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Uchl1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Uchl1Sample Type: Rat Stomach lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-UCHL1 antibody
This is a rabbit polyclonal antibody against Uchl1. It was validated on Western Blot

Target Description: UCHL1 catalyzes the hydrolysis of ubiquitin carboxy-terminal thiolesters to form ubiquitin and a thiol; It may play a role in neuropathic pain.
Product Categories/Family for anti-UCHL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase isozyme L1
NCBI Official Synonym Full Names
ubiquitin C-terminal hydrolase L1
NCBI Official Symbol
Uchl1
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase isozyme L1
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase isozyme L1
UniProt Gene Name
Uchl1
UniProt Synonym Gene Names
UCH-L1; PGP9.5

NCBI Description

catalyzes the hydrolysis of ubiquitin carboxy-terminal thiolesters to form ubiquitin and a thiol; may play a role in neuropathic pain [RGD, Feb 2006]

Uniprot Description

Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity ().

Research Articles on UCHL1

Similar Products

Product Notes

The UCHL1 uchl1 (Catalog #AAA3214268) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCHL1 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UCHL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UCHL1 uchl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNQDKLEFED GSVLKQFLSE TEKLSPEDRA KCFEKNEAIQ AAHDSVAQEG. It is sometimes possible for the material contained within the vial of "UCHL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.