Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Daudi cell lysateUBP1 is supported by BioGPS gene expression data to be expressed in Daudi)

Rabbit UBP1 Polyclonal Antibody | anti-UBP1 antibody

UBP1 antibody - middle region

Gene Names
UBP1; LBP1A; LBP1B; LBP-1B; LBP-1a
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBP1; Polyclonal Antibody; UBP1 antibody - middle region; anti-UBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED
Sequence Length
540
Applicable Applications for anti-UBP1 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Daudi cell lysateUBP1 is supported by BioGPS gene expression data to be expressed in Daudi)

Western Blot (WB) (WB Suggested Anti-UBP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Daudi cell lysateUBP1 is supported by BioGPS gene expression data to be expressed in Daudi)
Related Product Information for anti-UBP1 antibody
This is a rabbit polyclonal antibody against UBP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBP1 is an important SF1-independent transcriptional activator stimulating P450scc expression in human placental JEG-3 cells, whereas LBP-9 modulates the action of UBP1, exerting both positive and negative effects

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
upstream-binding protein 1 isoform LBP-1b
NCBI Official Synonym Full Names
upstream binding protein 1
NCBI Official Symbol
UBP1
NCBI Official Synonym Symbols
LBP1A; LBP1B; LBP-1B; LBP-1a
NCBI Protein Information
upstream-binding protein 1
UniProt Protein Name
Upstream-binding protein 1
Protein Family
UniProt Gene Name
UBP1
UniProt Synonym Gene Names
LBP1
UniProt Entry Name
UBIP1_HUMAN

Uniprot Description

UBP1: Functions as a transcriptional activator in a promoter context-dependent manner. Modulates the placental expression of CYP11A1. Involved in regulation of the alpha-globin gene in erythroid cells. Activation of the alpha-globin promoter in erythroid cells is via synergistic interaction with TFCP2. Involved in regulation of the alpha-globin gene in erythroid cells. Binds strongly to sequences around the HIV-1 initiation site and weakly over the TATA-box. Represses HIV-1 transcription by inhibiting the binding of TFIID to the TATA-box. Belongs to the grh/CP2 family. CP2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3p22.3

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; transcription factor activity; transcription corepressor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; viral genome replication; angiogenesis; negative regulation of transcription, DNA-dependent

Research Articles on UBP1

Similar Products

Product Notes

The UBP1 ubp1 (Catalog #AAA3201546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBP1 antibody - middle region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBP1 ubp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GASQTSGEQI QPSATIQETQ QWLLKNRFSS YTRLFSNFSG ADLLKLTKED. It is sometimes possible for the material contained within the vial of "UBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.