Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit TFCP2L1 Polyclonal Antibody | anti-TFCP2L1 antibody

TFCP2L1 antibody - middle region

Gene Names
TFCP2L1; LBP9; CRTR1; LBP-9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TFCP2L1; Polyclonal Antibody; TFCP2L1 antibody - middle region; anti-TFCP2L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTD
Sequence Length
479
Applicable Applications for anti-TFCP2L1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TFCP2L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TFCP2L1 antibody
This is a rabbit polyclonal antibody against TFCP2L1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TFCP2L1 is a transcriptional suppressor. TFCP2L1 may suppress UBP1-mediated transcriptional activation. It modulates the placental expression of CYP11A1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
transcription factor CP2-like protein 1
NCBI Official Synonym Full Names
transcription factor CP2 like 1
NCBI Official Symbol
TFCP2L1
NCBI Official Synonym Symbols
LBP9; CRTR1; LBP-9
NCBI Protein Information
transcription factor CP2-like protein 1
UniProt Protein Name
Transcription factor CP2-like protein 1
UniProt Gene Name
TFCP2L1
UniProt Synonym Gene Names
CRTR1; LBP9; CRTR-1
UniProt Entry Name
TF2L1_HUMAN

Uniprot Description

TFCP2L1: Transcriptional suppressor. May suppress UBP1-mediated transcriptional activation. Required for normal duct development in the salivary gland and kidney. Modulates the placental expression of CYP11A1. Belongs to the grh/CP2 family. CP2 subfamily.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q14

Cellular Component: membrane; cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; transcription corepressor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; salivary gland development; epithelial cell maturation; cell morphogenesis; cytoplasm organization and biogenesis; female pregnancy; determination of adult life span; negative regulation of transcription from RNA polymerase II promoter; steroid biosynthetic process; positive regulation of growth

Research Articles on TFCP2L1

Similar Products

Product Notes

The TFCP2L1 tfcp2l1 (Catalog #AAA3201043) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFCP2L1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TFCP2L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TFCP2L1 tfcp2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HGGEKGVPFR VQIDTFKQNE NGEYTEHLHS ASCQIKVFKP KGADRKQKTD. It is sometimes possible for the material contained within the vial of "TFCP2L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.