Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TNFAIP3 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit TNFAIP3 Polyclonal Antibody | anti-TNFAIP3 antibody

TNFAIP3 Antibody

Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry
Purity
Affinity Purified
Synonyms
TNFAIP3; Polyclonal Antibody; TNFAIP3 Antibody; Tumor necrosis factor alpha-induced protein 3; YWHAQ; TNIP1; TNIP3; ARRDC3; RNF114; UBE2D1; UBC; TRAF2; TRIM23; ELAVL1; MALT1; OCLN; TP53; BIRC3; BIRC2; NFKB2; AXIN1; GIT2; IKBKG; LAPTM5; YWHAZ; YWHAE; RNF11; HSP90AA1; RNF5; RLIM; TRIM2; RBCK1; TRIM3; RNF14; TRIM5; TRIM8; TRAF6; SHARPIN; RNF3; A20; OTUD7C; TNFA1P2; anti-TNFAIP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP
Applicable Applications for anti-TNFAIP3 antibody
Immunohistochemistry (IHC)
Protein Size
790 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP
Predicted Homology Based on Immunogen Sequence
Cow: 77%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TNFAIP3 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-TNFAIP3 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-TNFAIP3 antibody
Description of Target: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
90kDa
UniProt Protein Name
Tumor necrosis factor alpha-induced protein 3
UniProt Gene Name
TNFAIP3
UniProt Synonym Gene Names
OTUD7C; TNF alpha-induced protein 3
UniProt Entry Name
TNAP3_HUMAN

Uniprot Description

TNFAIP3: Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity. Essential component of a ubiquitin-editing protein complex, comprising also RNF11, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1 promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways; affected are at least E3 ligases TRAF6, TRAF2 and BIRC2, and E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. In cooperation with TAX1BP1 promotes ubiquitination of UBE2N and proteasomal degradation of UBE2N and UBE2D3. Upon TNF stimulation, deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Deubiquinates TRAF6 probably acting on 'Lys-63'-linked polyubiquitin. Upon T-cell receptor (TCR)-mediated T-cell activation, deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1 thereby mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes and preventing sustained IKK activation. Deubiquinates NEMO/IKBKG; the function is facilitated by TNIP1 and leads to inhibition of NF-kappa-B activation. Upon stimulation by bacterial peptidoglycans, probably deubiquitinates RIPK2. Can also inhibit I-kappa-B-kinase (IKK) through a non-catalytic mechanism which involves polyubiquitin; polyubiquitin promotes association with IKBKG and prevents IKK MAP3K7-mediated phosphorylation. Targets TRAF2 for lysosomal degradation. In vitro able to deubiquitinate both 'Lys-48'- and 'Lys-63' polyubiquitin chains. Inhibitor of programmed cell death. Has a role in the function of the lymphoid system. Homodimer. Interacts with TNIP1, TAX1BP1 and TRAF2. Interacts with RNF11, ITCH and TAX1BP1 only after TNF stimulation; these interaction are transient and they are lost after 1 hour of stimulation with TNF. Interacts with YWHAZ and YWHAH. Interacts with IKBKG; the interaction is induced by TNF stimulation and by polyubiquitin. Interacts with RIPK1. Interacts with UBE2N; the interaction requires TAX1BP1. Interacts with TRAF6; the interaction is inhibited by HTLV-1 protein Tax. By TNF. Belongs to the peptidase C64 family.

Protein type: Apoptosis; EC 3.4.19.12; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6q23

Cellular Component: centrosome; lysosome; cytoplasm; cytosol; nucleus

Molecular Function: ubiquitin binding; protein binding; DNA binding; protease binding; protein self-association; zinc ion binding; ubiquitin-specific protease activity; ubiquitin-protein ligase activity; kinase binding; ligase activity

Biological Process: negative regulation of toll-like receptor 5 signaling pathway; negative regulation of smooth muscle cell proliferation; apoptosis; proteolysis; negative regulation of toll-like receptor 3 signaling pathway; negative regulation of interleukin-2 production; negative regulation of innate immune response; response to molecule of bacterial origin; negative regulation of interleukin-6 production; inflammatory response; negative regulation of bone resorption; negative regulation of chronic inflammatory response; protein deubiquitination; negative regulation of toll-like receptor 2 signaling pathway; negative regulation of cyclin-dependent protein kinase activity; B-1 B cell homeostasis; negative regulation of B cell activation; negative regulation of interleukin-1 beta production; negative regulation of tumor necrosis factor production; negative regulation of I-kappaB kinase/NF-kappaB cascade; protein oligomerization; regulation of germinal center formation; inhibition of NF-kappaB transcription factor; response to muramyl dipeptide; negative regulation of inflammatory response; negative regulation of toll-like receptor 4 signaling pathway; positive regulation of protein catabolic process; innate immune response; negative regulation of protein ubiquitination; regulation of defense response to virus by host; negative regulation of interferon type I production

Similar Products

Product Notes

The TNFAIP3 tnfaip3 (Catalog #AAA3249640) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFAIP3 Antibody reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TNFAIP3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the TNFAIP3 tnfaip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGSTMFEGYC QKCFIEAQNQ RFHEAKRTEE QLRSSQRRDV PRTTQSTSRP. It is sometimes possible for the material contained within the vial of "TNFAIP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.