Western Blot (WB)
(WB Suggested Anti-UBE4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateUBE4A is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit UBE4A Polyclonal Antibody | anti-UBE4A antibody
UBE4A antibody - middle region
Gene Names
UBE4A; E4; UFD2; UBOX2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE4A; Polyclonal Antibody; UBE4A antibody - middle region; anti-UBE4A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR
Sequence Length
1073
Applicable Applications for anti-UBE4A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-UBE4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateUBE4A is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-UBE4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateUBE4A is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-UBE4A antibody
This is a rabbit polyclonal antibody against UBE4A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.
Product Categories/Family for anti-UBE4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
123kDa
NCBI Official Full Name
ubiquitin conjugation factor E4 A isoform 1
NCBI Official Synonym Full Names
ubiquitination factor E4A
NCBI Official Symbol
UBE4A
NCBI Official Synonym Symbols
E4; UFD2; UBOX2
NCBI Protein Information
ubiquitin conjugation factor E4 A
Protein Family
NCBI Description
This gene encodes a member of the U-box ubiquitin ligase family. The encoded protein is involved in multiubiquitin chain assembly and plays a critical role in chromosome condensation and separation through the polyubiquitination of securin. Autoantibodies against the encoded protein may be markers for scleroderma and Crohn's disease. A pseudogene of this gene is located on the long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]
Research Articles on UBE4A
Similar Products
Product Notes
The UBE4A (Catalog #AAA3206678) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE4A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE4A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QYAPQLAEAL IKVFVDIEFT GDPHQFEQKF NYRRPMYPIL RYMWGTDTYR. It is sometimes possible for the material contained within the vial of "UBE4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
