Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBE4B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit UBE4B Polyclonal Antibody | anti-UBE4B antibody

UBE4B antibody - N-terminal region

Gene Names
UBE4B; E4; UFD2; HDNB1; UBOX3; UFD2A
Reactivity
Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE4B; Polyclonal Antibody; UBE4B antibody - N-terminal region; anti-UBE4B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL
Sequence Length
1302
Applicable Applications for anti-UBE4B antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UBE4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBE4B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-UBE4B Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-UBE4B antibody
This is a rabbit polyclonal antibody against UBE4B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4B is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. The gene that encodes the protein is also the strongest candidate in the neuroblastoma tumor suppressor genes. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-UBE4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
146kDa
NCBI Official Full Name
ubiquitin conjugation factor E4 B isoform 1
NCBI Official Synonym Full Names
ubiquitination factor E4B
NCBI Official Symbol
UBE4B
NCBI Official Synonym Symbols
E4; UFD2; HDNB1; UBOX3; UFD2A
NCBI Protein Information
ubiquitin conjugation factor E4 B
UniProt Protein Name
Ubiquitin conjugation factor E4 B
UniProt Gene Name
UBE4B
UniProt Entry Name
UBE4B_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly. This gene is also the strongest candidate in the neuroblastoma tumor suppressor genes. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

UBE4B: Binds to the ubiquitin moieties of preformed conjugates and catalyzes ubiquitin chain assembly in conjunction with E1, E2, and E3. Belongs to the ubiquitin conjugation factor E4 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.19; EC 6.3.2.-; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 1p36.3

Cellular Component: cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: enzyme binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; induction of apoptosis by granzyme; protein ubiquitination during ubiquitin-dependent protein catabolic process; response to UV

Research Articles on UBE4B

Similar Products

Product Notes

The UBE4B ube4b (Catalog #AAA3211734) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE4B antibody - N-terminal region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's UBE4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBE4B ube4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPMFCSVASF GASSLSSLYE SSPAPTPSFW SSVPVMGPSL ASPSRAASQL. It is sometimes possible for the material contained within the vial of "UBE4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.