Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UBD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateUBD is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit UBD Polyclonal Antibody | anti-UBD antibody

UBD antibody - N-terminal region

Gene Names
UBD; FAT10; UBD-3; GABBR1
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBD; Polyclonal Antibody; UBD antibody - N-terminal region; anti-UBD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE
Sequence Length
165
Applicable Applications for anti-UBD antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UBD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UBD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateUBD is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-UBD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateUBD is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-UBD antibody
This is a rabbit polyclonal antibody against UBD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.
Product Categories/Family for anti-UBD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
ubiquitin D
NCBI Official Synonym Full Names
ubiquitin D
NCBI Official Symbol
UBD
NCBI Official Synonym Symbols
FAT10; UBD-3; GABBR1
NCBI Protein Information
ubiquitin D
UniProt Protein Name
Ubiquitin D
Protein Family
UniProt Gene Name
UBD
UniProt Synonym Gene Names
FAT10
UniProt Entry Name
UBD_HUMAN

NCBI Description

This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicated to function in many cellular processes, including caspase-dependent apoptosis, formation of aggresomes, mitotic regulation, and dendritic cell maturation. Upregulation of this gene may promote inflammation in chronic kidney disease and has been observed in many cancer types. [provided by RefSeq, Aug 2017]

Uniprot Description

FAT10: Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)- associated nephropathy (HIVAN).

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: ubiquitin-dependent protein catabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein modification by small protein conjugation; positive regulation of apoptosis; protein ubiquitination; myeloid dendritic cell differentiation; proteolysis; response to organic nitrogen

Research Articles on UBD

Similar Products

Product Notes

The UBD ubd (Catalog #AAA3208088) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBD antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UBD ubd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSKTKVPVQD QVLLLGSKIL KPRRSLSSYG IDKEKTIHLT LKVVKPSDEE. It is sometimes possible for the material contained within the vial of "UBD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.