Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CTNND1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateCTNND1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Rabbit CTNND1 Polyclonal Antibody | anti-CTNND1 antibody

CTNND1 antibody - N-terminal region

Gene Names
CTNND1; CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN)
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTNND1; Polyclonal Antibody; CTNND1 antibody - N-terminal region; anti-CTNND1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY
Sequence Length
832
Applicable Applications for anti-CTNND1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTNND1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CTNND1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateCTNND1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Western Blot (WB) (WB Suggested Anti-CTNND1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateCTNND1 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)
Related Product Information for anti-CTNND1 antibody
This is a rabbit polyclonal antibody against CTNND1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of t
Product Categories/Family for anti-CTNND1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
catenin delta-1 isoform 3A
NCBI Official Synonym Full Names
catenin delta 1
NCBI Official Symbol
CTNND1
NCBI Official Synonym Symbols
CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN)
NCBI Protein Information
catenin delta-1
UniProt Protein Name
Catenin delta-1
Protein Family
UniProt Gene Name
CTNND1
UniProt Synonym Gene Names
KIAA0384; CAS; p120(ctn)
UniProt Entry Name
CTND1_HUMAN

NCBI Description

This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene. [provided by RefSeq, Dec 2010]

Uniprot Description

CTNND1: an Arm repeat protein that interacts with varied components such as cadherin, small G proteins, kinases, and the Kaiso transcriptional repressor. A downstream modulator of Wnt/beta-catenin signaling pathway whose stability may be regulated downstream of Dsh. Required for the invasiveness of E-cadherin-deficient cells. A signal coordinator between cadherins and Rho-family GTPases to regulate cytoskeletal changes required during dendritic spine and synapse development. The association of catenins with cadherins produces a complex which is linked to the actin filament network, and which seems to be of primary importance for cadherins cell-adhesion properties. Thirty two splice-variant isoforms have been described.

Protein type: Adaptor/scaffold; G protein regulator, misc.; Motility/polarity/chemotaxis; Cell adhesion; Actin-binding

Chromosomal Location of Human Ortholog: 11q11

Cellular Component: growth cone; lamellipodium; cytoplasm; dendritic spine; plasma membrane; synapse; intercellular junction; midbody; zonula adherens; nucleus; cytosol

Molecular Function: protein binding; cadherin binding; protein kinase binding; receptor binding

Biological Process: intercellular junction assembly and maintenance; cell-cell adhesion; Wnt receptor signaling pathway; regulation of transcription, DNA-dependent; transcription, DNA-dependent; brain development; vascular endothelial growth factor receptor signaling pathway; cell adhesion

Research Articles on CTNND1

Similar Products

Product Notes

The CTNND1 ctnnd1 (Catalog #AAA3210489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTNND1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTNND1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTNND1 ctnnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPPDGYSRHY EDGYPGGSDN YGSLSRVTRI EERYRPSMEG YRAPSRQDVY. It is sometimes possible for the material contained within the vial of "CTNND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.