Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit IFIT5 Polyclonal Antibody | anti-IFIT5 antibody

IFIT5 antibody - middle region

Gene Names
IFIT5; P58; RI58; ISG58
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFIT5; Polyclonal Antibody; IFIT5 antibody - middle region; anti-IFIT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE
Sequence Length
482
Applicable Applications for anti-IFIT5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IFIT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: IFIT5Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IFIT5Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-IFIT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateIFIT5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-IFIT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateIFIT5 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-IFIT5 antibody
This is a rabbit polyclonal antibody against IFIT5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.
Product Categories/Family for anti-IFIT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
interferon-induced protein with tetratricopeptide repeats 5
NCBI Official Synonym Full Names
interferon induced protein with tetratricopeptide repeats 5
NCBI Official Symbol
IFIT5
NCBI Official Synonym Symbols
P58; RI58; ISG58
NCBI Protein Information
interferon-induced protein with tetratricopeptide repeats 5
UniProt Protein Name
Interferon-induced protein with tetratricopeptide repeats 5
UniProt Gene Name
IFIT5
UniProt Synonym Gene Names
ISG58; RI58; IFIT-5; P58
UniProt Entry Name
IFIT5_HUMAN

Uniprot Description

IFIT5: IFN-induced antiviral protein which acts as an inhibitor of cellular as well as viral processes, cell migration, proliferation, signaling, and viral replication. Belongs to the IFIT family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 10q23.31

Cellular Component: apical part of cell; actin cytoskeleton

Molecular Function: single-stranded RNA binding; RNA binding; tRNA binding

Biological Process: innate immune response; defense response to virus

Research Articles on IFIT5

Similar Products

Product Notes

The IFIT5 ifit5 (Catalog #AAA3211931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFIT5 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFIT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFIT5 ifit5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITVYRLDDSD REGSVKSFSL GPLRKAVTLN PDNSYIKVFL ALKLQDVHAE. It is sometimes possible for the material contained within the vial of "IFIT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.