Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts from normal (control) and Twist knockout (KO) 293T cells, using Twist antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit Twist Polyclonal Antibody | anti-Twist antibody

[KO Validated] Twist Rabbit pAb

Gene Names
TWIST1; CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; TWIST; bHLHa38
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
Twist; Polyclonal Antibody; [KO Validated] Twist Rabbit pAb; TWIST1; ACS3; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST; bHLHa38; anti-Twist antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSP
Applicable Applications for anti-Twist antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Twist (NP_000465.1).
Cellular Location
Nucleus
Positive Samples
293T, A-549, NIH/3T3, Mouse brain, Mouse heart, Rat brain, Rat heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts from normal (control) and Twist knockout (KO) 293T cells, using Twist antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts from normal (control) and Twist knockout (KO) 293T cells, using Twist antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using Twist antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Twist antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat liver using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat liver using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human esophageal cancer using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human esophageal cancer using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded mouse lung using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded mouse lung using Twist Rabbit pAb at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-Twist antibody
Background: Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,954 Da
NCBI Official Full Name
Homo sapiens twist family bHLH transcription factor 1 (TWIST1), mRNA
NCBI Official Synonym Full Names
twist family bHLH transcription factor 1
NCBI Official Symbol
TWIST1
NCBI Official Synonym Symbols
CRS; CSO; SCS; ACS3; CRS1; BPES2; BPES3; TWIST; bHLHa38
NCBI Protein Information
twist-related protein 1; B-HLH DNA binding protein; H-twist; TWIST homolog of drosophila; class A basic helix-loop-helix protein 38; twist basic helix-loop-helix transcription factor 1; twist homolog 1
UniProt Protein Name
Twist-related protein 1
Protein Family
UniProt Gene Name
TWIST1
UniProt Synonym Gene Names
BHLHA38; TWIST; bHLHa38
UniProt Entry Name
TWST1_HUMAN

NCBI Description

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. [provided by RefSeq, Jul 2008]

Research Articles on Twist

Similar Products

Product Notes

The Twist twist1 (Catalog #AAA9142061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Twist Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Twist can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the Twist twist1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MMQDVSSSPV SPADDSLSNS EEEPDRQQPP SGKRGGRKRR SSRRSAGGGA GPGGAAGGGV GGGDEPGSPA QGKRGKKSAG CGGGGGAGGG GGSSSGGGSP. It is sometimes possible for the material contained within the vial of "Twist, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.