Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TUB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit anti-Human, Rat TUB Polyclonal Antibody | anti-TUB antibody

TUB Rabbit pAb

Gene Names
TUB; rd5; RDOB
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
TUB; Polyclonal Antibody; TUB Rabbit pAb; RDOB; rd5; anti-TUB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LSSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKSEAQGPVQILTVGQSDHAQDAGETAAGGGER
Applicable Applications for anti-TUB antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 130-230 of human TUB (NP_003311.2).
Positive Samples
U-87MG, U-251MG, PC-3
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using TUB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using TUB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-TUB antibody
Background: This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,091 Da
NCBI Official Full Name
tubby protein homolog isoform a
NCBI Official Synonym Full Names
tubby bipartite transcription factor
NCBI Official Symbol
TUB
NCBI Official Synonym Symbols
rd5; RDOB
NCBI Protein Information
tubby protein homolog
UniProt Protein Name
Tubby protein homolog
Protein Family
UniProt Gene Name
TUB

NCBI Description

This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

tubby: an effector protein for heterotrimeric G protein-coupled receptors. Binds phospholipid and is anchored to the plasma membrane through binding phosphatidylinositol-4,5-bisphosphate. Is released upon activation of phospholipase C. Translocates from the plasma membrane to the nucleus upon activation by the G-alpha(q)/(11) subclass of G proteins that are linked to receptors including the seratonin receptor 5-HT(2C). Can bind DNA in vitro and may contribute to the regulation of transcription in the nucleus. TUB can be phosphorylated by the insulin receptor and may participate in insulin receptor signaling. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway. Highly expressed in the paraventricular nucleus of the hypothalamus and several other brain regions. May play a role in the hypothalamic regulation of body weight. Contributes to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages. Belongs to the TUB family. Mutations in the tubby promote maturity-onset obesity in mice. Interacts with GNAQ. Interacts with TULP1. Two isoforms of the human protein are produced through alternative splicing.

Protein type: Lipid-binding; Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: cilium; cytoplasm

Molecular Function: phosphoinositide binding; protein complex binding

Biological Process: positive regulation of phagocytosis

Disease: Retinal Dystrophy And Obesity

Research Articles on TUB

Similar Products

Product Notes

The TUB tub (Catalog #AAA9142837) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUB Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TUB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TUB tub for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSSSGSTSYQ VQEADSLASV QLGATRPTAP ASAKRTKAAA TAGGQGGAAR KEKKGKHKGT SGPAALAEDK SEAQGPVQIL TVGQSDHAQD AGETAAGGGE R. It is sometimes possible for the material contained within the vial of "TUB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.