Western Blot (WB)
(TTC12 antibody (MBS5301293) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Rat TTC12 Polyclonal Antibody | anti-TTC12 antibody
TTC12 antibody
Gene Names
TTC12; TPARM
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TTC12; Polyclonal Antibody; TTC12 antibody; Polyclonal TTC12; Anti-TTC12; FLJ20535; TTC-12; TPARM; TTC 12; Tetratricopeptide Repeat Domain 12; FLJ13859; anti-TTC12 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
TTC12 antibody was raised against the C terminal of TTC12
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC12 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
705
Applicable Applications for anti-TTC12 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.
Cross-Reactivity
Human,Rat
Immunogen
TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TTC12 antibody (MBS5301293) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TTC12 antibody (MBS5301293) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TTC12 antibody
Rabbit polyclonal TTC12 antibody raised against the C terminal of TTC12
Product Categories/Family for anti-TTC12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81 kDa (MW of target protein)
NCBI Official Full Name
tetratricopeptide repeat protein 12
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 12
NCBI Official Symbol
TTC12
NCBI Official Synonym Symbols
TPARM
NCBI Protein Information
tetratricopeptide repeat protein 12
UniProt Protein Name
Tetratricopeptide repeat protein 12
Protein Family
UniProt Gene Name
TTC12
UniProt Synonym Gene Names
TPR repeat protein 12
UniProt Entry Name
TTC12_HUMAN
Uniprot Description
TTC12: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 11q23.2
Research Articles on TTC12
Similar Products
Product Notes
The TTC12 ttc12 (Catalog #AAA5301293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TTC12 antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TTC12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TTC12 ttc12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TTC12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
