Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Integrin Beta 8 antibody (MBS5300290) used at 1 ug/ml to detect target protein.)

Rabbit Integrin Beta 8 Polyclonal Antibody | anti-ITGB8 antibody

Integrin Beta 8 antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
Integrin Beta 8; Polyclonal Antibody; Integrin Beta 8 antibody; Polyclonal Integrin Beta 8; Anti-Integrin Beta 8; ITGB8; anti-ITGB8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Integrin Beta 8 antibody was raised against the C terminal of ITGB8
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGB8 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
769
Applicable Applications for anti-ITGB8 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ITGB8 is a member of the integrin beta chain family and is a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation.
Cross-Reactivity
Human
Immunogen
Integrin Beta 8 antibody was raised using the C terminal of ITGB8 corresponding to a region with amino acids CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Integrin Beta 8 antibody (MBS5300290) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Integrin Beta 8 antibody (MBS5300290) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ITGB8 antibody
Rabbit polyclonal Integrin Beta 8 antibody raised against the C terminal of ITGB8
Product Categories/Family for anti-ITGB8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
81 kDa (MW of target protein)
NCBI Official Full Name
integrin beta-8
NCBI Official Synonym Full Names
integrin, beta 8
NCBI Official Symbol
ITGB8
NCBI Protein Information
integrin beta-8
UniProt Protein Name
Integrin beta-8
Protein Family
UniProt Gene Name
ITGB8
UniProt Entry Name
ITB8_HUMAN

NCBI Description

This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGB8: Integrin alpha-V/beta-8 is a receptor for fibronectin. Belongs to the integrin beta chain family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 7p21.1

Cellular Component: cell surface; plasma membrane; integrin complex

Molecular Function: receptor activity; receptor binding

Biological Process: integrin-mediated signaling pathway; extracellular matrix organization and biogenesis; cell-matrix adhesion; cartilage development; cell adhesion; ganglioside metabolic process

Research Articles on ITGB8

Similar Products

Product Notes

The ITGB8 itgb8 (Catalog #AAA5300290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Integrin Beta 8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ITGB8 itgb8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin Beta 8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.