Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TSSK6 rabbit polyclonal antibody. Western Blot analysis of TSSK6 expression in human colon.)

Rabbit anti-Human TSSK6 Polyclonal Antibody | anti-TSSK6 antibody

TSSK6 (Testis-specific Serine/threonine-protein Kinase 6, TSSK-6, Testis-specific Kinase 6, TSK-6, Cancer/testis Antigen 72, CT72, FKSG82, Serine/threonine-protein Kinase SSTK, Small Serine/threonine Kinase, SSTK) (AP)

Gene Names
TSSK6; CT72; SSTK; TSSK4; FKSG82
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSSK6; Polyclonal Antibody; TSSK6 (Testis-specific Serine/threonine-protein Kinase 6; TSSK-6; Testis-specific Kinase 6; TSK-6; Cancer/testis Antigen 72; CT72; FKSG82; Serine/threonine-protein Kinase SSTK; Small Serine/threonine Kinase; SSTK) (AP); EC=2.7.11.1; anti-TSSK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TSSK6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TSSK6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TSSK6, aa1-273 (NP_114426.1).
Immunogen Sequence
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TSSK6 rabbit polyclonal antibody. Western Blot analysis of TSSK6 expression in human colon.)

Western Blot (WB) (TSSK6 rabbit polyclonal antibody. Western Blot analysis of TSSK6 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of TSSK6 expression in transfected 293T cell line by TSSK6 polyclonal antibody. Lane 1: TSSK6 transfected lysate (30.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TSSK6 expression in transfected 293T cell line by TSSK6 polyclonal antibody. Lane 1: TSSK6 transfected lysate (30.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TSSK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,331 Da
NCBI Official Full Name
testis-specific serine/threonine-protein kinase 6
NCBI Official Synonym Full Names
testis-specific serine kinase 6
NCBI Official Symbol
TSSK6
NCBI Official Synonym Symbols
CT72; SSTK; TSSK4; FKSG82
NCBI Protein Information
testis-specific serine/threonine-protein kinase 6; TSK-6; cancer/testis antigen 72; small serine/threonine kinase; serine/threonine protein kinase SSTK
UniProt Protein Name
Testis-specific serine/threonine-protein kinase 6
UniProt Gene Name
TSSK6
UniProt Synonym Gene Names
TSK-6; TSSK-6; Testis-specific kinase 6; CT72

NCBI Description

This intronless gene encodes a member of the CAMK (calcium/calmodulin-dependent) serine/threonine protein kinase family. The encoded kinase has a broad expression pattern but is described as testis-specific due to effects on fertility. Male mice which lack the gene encoding a highly similar protein are sterile and have morphologically abnormal sperm. [provided by RefSeq, Jan 2012]

Uniprot Description

Required for sperm production and function. Plays a role in DNA condensation during postmeiotic chromatin remodeling ().

Research Articles on TSSK6

Similar Products

Product Notes

The TSSK6 tssk6 (Catalog #AAA6397413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSSK6 (Testis-specific Serine/threonine-protein Kinase 6, TSSK-6, Testis-specific Kinase 6, TSK-6, Cancer/testis Antigen 72, CT72, FKSG82, Serine/threonine-protein Kinase SSTK, Small Serine/threonine Kinase, SSTK) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSSK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSSK6 tssk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSSK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.