Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Tsen15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Rabbit Tsen15 Polyclonal Antibody | anti-TSEN15 antibody

Tsen15 antibody - C-terminal region

Gene Names
Tsen15; Sen15; AL023077; 5730449L18Rik
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tsen15; Polyclonal Antibody; Tsen15 antibody - C-terminal region; anti-TSEN15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASLSHNRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFML
Sequence Length
168
Applicable Applications for anti-TSEN15 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Tsen15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)

Western Blot (WB) (WB Suggested Anti-Tsen15 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Spleen)
Related Product Information for anti-TSEN15 antibody
This is a rabbit polyclonal antibody against Tsen15. It was validated on Western Blot

Target Description: Tsen15 is a non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3' end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3' end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.
Product Categories/Family for anti-TSEN15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
tRNA-splicing endonuclease subunit Sen15
NCBI Official Synonym Full Names
tRNA splicing endonuclease subunit 15
NCBI Official Symbol
Tsen15
NCBI Official Synonym Symbols
Sen15; AL023077; 5730449L18Rik
NCBI Protein Information
tRNA-splicing endonuclease subunit Sen15
UniProt Protein Name
tRNA-splicing endonuclease subunit Sen15
UniProt Gene Name
Tsen15
UniProt Synonym Gene Names
Sen15
UniProt Entry Name
SEN15_MOUSE

Similar Products

Product Notes

The TSEN15 tsen15 (Catalog #AAA3210806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tsen15 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tsen15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSEN15 tsen15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASLSHNRIRE ILKASRKLQG DPELPMSFTL AIVESDSTIV YYKLTDGFML. It is sometimes possible for the material contained within the vial of "Tsen15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.