Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Gfm1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Gfm1 Polyclonal Antibody | anti-GFM1 antibody

Gfm1 antibody - C-terminal region

Gene Names
Gfm1; Gfm; AW545374; D3Wsu133e
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Gfm1; Polyclonal Antibody; Gfm1 antibody - C-terminal region; anti-GFM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN
Sequence Length
751
Applicable Applications for anti-GFM1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Gfm1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Western Blot (WB) (WB Suggested Anti-Gfm1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-GFM1 antibody
This is a rabbit polyclonal antibody against Gfm1. It was validated on Western Blot

Target Description: Gfm1 is a mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Gfm1 catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Gfm1 does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis.
Product Categories/Family for anti-GFM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
elongation factor G, mitochondrial
NCBI Official Synonym Full Names
G elongation factor, mitochondrial 1
NCBI Official Symbol
Gfm1
NCBI Official Synonym Symbols
Gfm; AW545374; D3Wsu133e
NCBI Protein Information
elongation factor G, mitochondrial
UniProt Protein Name
Elongation factor G, mitochondrial
UniProt Gene Name
Gfm1
UniProt Synonym Gene Names
Efg; Efg1; Gfm; EF-Gmt; mEF-G 1
UniProt Entry Name
EFGM_MOUSE

Uniprot Description

EFG1: Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A- site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis. Defects in GFM1 are the cause of combined oxidative phosphorylation deficiency type 1 (COXPD1). It leads to early fatal progressive hepatoencephalopathy. Belongs to the GTP-binding elongation factor family. EF-G/EF-2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; RNA-binding; Translation elongation

Cellular Component: intracellular; mitochondrion

Molecular Function: GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity

Biological Process: translation; translational elongation

Similar Products

Product Notes

The GFM1 gfm1 (Catalog #AAA3215008) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gfm1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Gfm1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GFM1 gfm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELRSCTEGKG EYTMEYCRYQ PCSPSTQEEL INKYLEATGQ LPVKKGKAKN. It is sometimes possible for the material contained within the vial of "Gfm1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.