Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TSEN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit TSEN2 Polyclonal Antibody | anti-TSEN2 antibody

TSEN2 antibody - C-terminal region

Gene Names
TSEN2; SEN2; PCH2B; SEN2L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSEN2; Polyclonal Antibody; TSEN2 antibody - C-terminal region; anti-TSEN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRRPLSWKSLAALSRVSVNVSKELMLCYLIKPSTMTDKEMESPECMKRIK
Sequence Length
465
Applicable Applications for anti-TSEN2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TSEN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-TSEN2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-TSEN2 antibody
This is a rabbit polyclonal antibody against TSEN2. It was validated on Western Blot

Target Description: This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
tRNA-splicing endonuclease subunit Sen2 isoform 1
NCBI Official Synonym Full Names
tRNA splicing endonuclease subunit 2
NCBI Official Symbol
TSEN2
NCBI Official Synonym Symbols
SEN2; PCH2B; SEN2L
NCBI Protein Information
tRNA-splicing endonuclease subunit Sen2
UniProt Protein Name
tRNA-splicing endonuclease subunit Sen2
UniProt Gene Name
TSEN2
UniProt Synonym Gene Names
SEN2; HsSen2
UniProt Entry Name
SEN2_HUMAN

NCBI Description

This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseudogene has been identified on chromosome 4. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2009]

Uniprot Description

Function: Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Isoform 1 probably carries the active site for 5'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Isoform 2 is responsible for processing a yet unknown RNA substrate. The complex containing isoform 2 is not able to cleave pre-tRNAs properly, although it retains endonucleolytic activity. Ref.1

Catalytic activity: Endonucleolytic cleavage of pre-tRNA, producing 5'-hydroxy and 2',3'-cyclic phosphate termini, and specifically removing the intron.

Subunit structure: tRNA splicing endonuclease is a heterotetramer composed of isoform 1 of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the pre-mRNA 3'-end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2. Isoform 2 belongs to a different complex that contains SEN54 but low level of SEN15 and SEN34/LENG5.

Subcellular location: Nucleus. Nucleus › nucleolus. Note: May be transiently localized in the nucleolus. Ref.1

Tissue specificity: Isoform 1 and isoform 2 are widely expressed at very low level. Ref.1

Involvement in disease: Pontocerebellar hypoplasia 2B (PCH2B) [MIM:612389]: A disorder characterized by an abnormally small cerebellum and brainstem, and progressive microcephaly from birth combined with extrapyramidal dyskinesia. Severe chorea occurs and epilepsy is frequent. There are no signs of spinal cord anterior horn cells degeneration.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.7

Sequence similarities: Belongs to the tRNA-intron endonuclease family.

Similar Products

Product Notes

The TSEN2 tsen2 (Catalog #AAA3215613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSEN2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's TSEN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSEN2 tsen2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRRPLSWKSL AALSRVSVNV SKELMLCYLI KPSTMTDKEM ESPECMKRIK. It is sometimes possible for the material contained within the vial of "TSEN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.