Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TRMT5Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TRMT5 Polyclonal Antibody | anti-TRMT5 antibody

TRMT5 Antibody - C-terminal region

Gene Names
TRMT5; TRM5; COXPD26; KIAA1393
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TRMT5; Polyclonal Antibody; TRMT5 Antibody - C-terminal region; anti-TRMT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNKEMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIV
Sequence Length
509
Applicable Applications for anti-TRMT5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRMT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TRMT5Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRMT5Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TRMT5 antibody
tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.
Product Categories/Family for anti-TRMT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
tRNA (guanine(37)-N1)-methyltransferase
NCBI Official Synonym Full Names
tRNA methyltransferase 5
NCBI Official Symbol
TRMT5
NCBI Official Synonym Symbols
TRM5; COXPD26; KIAA1393
NCBI Protein Information
tRNA (guanine(37)-N1)-methyltransferase
UniProt Protein Name
tRNA (guanine(37)-N1)-methyltransferase
UniProt Gene Name
TRMT5
UniProt Entry Name
TRM5_HUMAN

NCBI Description

tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine (Brule et al., 2004 [PubMed 15248782]).[supplied by OMIM, Mar 2008]

Uniprot Description

TRMT5: Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding. Belongs to the TRM5 / TYW2 family.

Protein type: EC 2.1.1.228; Methyltransferase

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: mitochondrial matrix; nucleus

Biological Process: tRNA methylation

Disease: Combined Oxidative Phosphorylation Deficiency 26

Research Articles on TRMT5

Similar Products

Product Notes

The TRMT5 trmt5 (Catalog #AAA3222165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRMT5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRMT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMT5 trmt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNKEMLCITF QIPASVLYKN QTRNPENHED PPLKRQRTAE AFSDEKTQIV. It is sometimes possible for the material contained within the vial of "TRMT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.