Rabbit anti-Mouse FBLL1 Polyclonal Antibody | anti-FBLL1 antibody

FBLL1 Antibody - C-terminal region

Cat. Num. AAA3224001

• Gene Names: Fbll1; AI595406
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: FBLL1; Polyclonal Antibody; FBLL1 Antibody - C-terminal region; anti-FBLL1 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ANCIDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRP
• Sequence Length: 327

• Applicable Applications for anti-FBLL1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse FBLL1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FBLL1Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-FBLL1 antibody

S-adenosyl-L-methionine-dependent methyltransferase that has the ability to methylate both RNAs and proteins. Involved in pre-rRNA processing by catalyzing the site-specific 2'-hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Also acts as a protein methyltransferase by mediating methylation of 'Gln-105' of histone H2A (H2AQ104me), a modification that impairs binding of the FACT complex and is specifically present at 35S ribosomal DNA locus (By similarity).

Product Categories/Family for anti-FBLL1 antibody

Polyclonal; Epigenetics

NCBI and Uniprot Product Information

• NCBI GI #: 51921297
• NCBI GeneID: 237730
• NCBI Accession #: NP_001004147.1
• NCBI GenBank Nucleotide #: NM_001004147.3
• UniProt Accession #: P35550; Q80WS3
• Molecular Weight: 35 kDa
• NCBI Official Full Name: rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1
• NCBI Official Synonym Full Names: fibrillarin-like 1
• NCBI Official Symbol: Fbll1
• NCBI Official Synonym Symbols: AI595406
• NCBI Protein Information: rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1
• UniProt Protein Name: rRNA 2'-O-methyltransferase fibrillarin
• Protein Family: rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein
• UniProt Gene Name: Fbl
• UniProt Entry Name: FBRL_MOUSE

Uniprot Description

FBL: Involved in pre-rRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'- hydroxyl methylation of ribose moieties in pre-ribosomal RNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA. Interacts with NOLC1. Component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles that contain NHP2L1, FBL, NOP5 and NOP56, plus a guide RNA. It is associated with the U3, U8, U13, X and Y small nuclear RNAs. Component of several ribosomal and nucleolar protein complexes. Interacts with PRMT5 and UTP20. Interacts with DDX5. Belongs to the methyltransferase superfamily. Fibrillarin family.

Protein type: Nucleolus; EC 2.1.1.-; RNA processing; Methyltransferase; RNA-binding

Cellular Component: Cajal body; granular component; dense fibrillar component; membrane; nucleolus; ribonucleoprotein complex; nucleus

Molecular Function: methyltransferase activity; monomethylamine methyltransferase activity; trimethylamine methyltransferase activity; RNA binding; tRNA (cytosine)-methyltransferase activity; RNA methyltransferase activity; rRNA (cytosine-C5-967)-methyltransferase activity; rRNA (uridine) methyltransferase activity; N-methyltransferase activity; tRNA (guanine) methyltransferase activity; rRNA (adenine-N6,N6-)-dimethyltransferase activity; selenocysteine methyltransferase activity; arginine N-methyltransferase activity; methanol-specific methylcobalamin:coenzyme M methyltransferase activity; protein-arginine N-methyltransferase activity; tRNA (guanine-N2-)-methyltransferase activity; dimethylamine methyltransferase activity; protein methyltransferase activity; 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity; transferase activity; hydroxyneurosporene-O-methyltransferase activity; rRNA (uridine-2'-O-)-methyltransferase activity; tRNA (uracil) methyltransferase activity; rRNA (adenine) methyltransferase activity; C-methyltransferase activity; cobalt-precorrin-6B C5-methyltransferase activity; cobalt-precorrin-3 C17-methyltransferase activity; 1-phenanthrol methyltransferase activity; S-methyltransferase activity; lysine N-methyltransferase activity; DNA-methyltransferase activity; tRNA (cytosine-5-)-methyltransferase activity; tRNA (adenine)-methyltransferase activity; C-terminal protein carboxyl methyltransferase activity; rRNA (cytosine) methyltransferase activity; cobalt-precorrin-7 C15-methyltransferase activity; protein-arginine N5-methyltransferase activity; rRNA methyltransferase activity; protein-leucine O-methyltransferase activity; demethylmenaquinone methyltransferase activity; rRNA (adenine-N6-)-methyltransferase activity; tRNA methyltransferase activity; rRNA (guanine) methyltransferase activity; methylarsonite methyltransferase activity; mRNA methyltransferase activity; methylamine-specific methylcobalamin:coenzyme M methyltransferase activity; tRNA (guanine-N1-)-methyltransferase activity; cobalt-precorrin-5B C1-methyltransferase activity; protein-lysine N-methyltransferase activity; O-methyltransferase activity; tRNA (adenine-N1-)-methyltransferase activity; tRNA (adenine-57, 58-N(1)-) methyltransferase activity

Biological Process: methylation; RNA processing; osteoblast differentiation; tRNA processing; snoRNA metabolic process; rRNA processing