Western Blot (WB)
(Western blot-TRIM27 Polyclonal Antibody)
Rabbit TRIM27 Polyclonal Antibody | anti-TRIM27 antibody
TRIM27 Polyclonal Antibody
Gene Names
TRIM27; RFP; RNF76
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
TRIM27; Polyclonal Antibody; TRIM27 Polyclonal Antibody; RFP; RNF76; zinc finger protein RFP; anti-TRIM27 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.21 mg/ml (varies by lot)
Sequence Length
513
Applicable Applications for anti-TRIM27 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1).
Immunogen Sequence
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRL
Positive Samples
HeLa, HepG2, Raji, SH-SY5Y
Cellular Location
Cytoplasm, Early Endosome, Nucleus, PML Body
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-TRIM27 Polyclonal Antibody)
Western Blot (WB)
(Western blot-TRIM27 Polyclonal Antibody)
Related Product Information for anti-TRIM27 antibody
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 41kDa; 58kDa
Observed: 58kDa
Observed: 58kDa
NCBI Official Full Name
zinc finger protein RFP
NCBI Official Synonym Full Names
tripartite motif containing 27
NCBI Official Symbol
TRIM27
NCBI Official Synonym Symbols
RFP; RNF76
NCBI Protein Information
zinc finger protein RFP
UniProt Protein Name
Zinc finger protein RFP
Protein Family
UniProt Gene Name
TRIM27
UniProt Synonym Gene Names
RFP; RNF76
UniProt Entry Name
TRI27_HUMAN
NCBI Description
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein. [provided by RefSeq, Jul 2008]
Research Articles on TRIM27
Similar Products
Product Notes
The TRIM27 trim27 (Catalog #AAA9140697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM27 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the TRIM27 trim27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
