Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Liver )

Rabbit TRIM17 Polyclonal Antibody | anti-TRIM17 antibody

TRIM17 antibody - middle region

Gene Names
TRIM17; RBCC; terf; RNF16
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TRIM17; Polyclonal Antibody; TRIM17 antibody - middle region; anti-TRIM17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPDATS
Sequence Length
477
Applicable Applications for anti-TRIM17 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Human: 100%; Mouse: 77%; Pig: 77%; Rabbit: 86%; Rat: 79%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIM17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Liver )

Immunohistochemistry (IHC) (Human Liver )

Western Blot (WB)

(WB Suggested Anti-TRIM17 Antibody Titration: 0.12ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-TRIM17 Antibody Titration: 0.12ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-TRIM17 antibody
This is a rabbit polyclonal antibody against TRIM17. It was validated on Western Blot and immunohistochemistry

Target Description: TRIM17 encodes a protein that is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed at high levels in the testis, but its function is unknown.
Product Categories/Family for anti-TRIM17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM17 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 17
NCBI Official Symbol
TRIM17
NCBI Official Synonym Symbols
RBCC; terf; RNF16
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM17
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM17
UniProt Gene Name
TRIM17
UniProt Synonym Gene Names
RBCC; RNF16; TERF
UniProt Entry Name
TRI17_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on TRIM17

Similar Products

Product Notes

The TRIM17 trim17 (Catalog #AAA3202127) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM17 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM17 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TRIM17 trim17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKEPLSRKNN VSVQCPEVAP PTRPRTVCRV PGQIEVLRGF LEDVVPDATS. It is sometimes possible for the material contained within the vial of "TRIM17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.