Testing Data
(Detection limit for recombinant GST tagged TRIM17 is 0.1 ng/ml as a capture antibody.)
Mouse TRIM17 Monoclonal Antibody | anti-TRIM17 antibody
TRIM17 (Tripartite Motif-Containing 17, RBCC, RNF16, terf) (AP)
Gene Names
TRIM17; RBCC; terf; RNF16
Applications
Western Blot
Purity
Purified
Synonyms
TRIM17; Monoclonal Antibody; TRIM17 (Tripartite Motif-Containing 17; RBCC; RNF16; terf) (AP); Tripartite Motif-Containing 17; terf; anti-TRIM17 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C4
Specificity
Recognizes TRIM17.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
477
Applicable Applications for anti-TRIM17 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRIM17 (NP_057186.1, 75aa-184aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRER
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TRIM17 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIM17 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-TRIM17 antibody
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-TRIM17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM17 isoform 1
NCBI Official Synonym Full Names
tripartite motif containing 17
NCBI Official Symbol
TRIM17
NCBI Official Synonym Symbols
RBCC; terf; RNF16
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM17
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM17
Protein Family
UniProt Gene Name
TRIM17
UniProt Synonym Gene Names
RBCC; RNF16; TERF
UniProt Entry Name
TRI17_HUMAN
NCBI Description
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on TRIM17
Similar Products
Product Notes
The TRIM17 trim17 (Catalog #AAA6164648) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIM17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM17 trim17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM17, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
